DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdia4 and CaBP1

DIOPT Version :9

Sequence 1:NP_001355685.1 Gene:Pdia4 / 12304 MGIID:104864 Length:699 Species:Mus musculus
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:470 Identity:129/470 - (27%)
Similarity:190/470 - (40%) Gaps:139/470 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse    58 NGVWVLNDGNFDNFVADKDTV-LLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSA 121
            :||..|...|||..|...|.: ::||||||||||:...|||:|:|..||.   .:.|..::|.:.
  Fly    25 DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADAD 86

Mouse   122 SMLASKFDVSGYPTIKIL--KKGQAVDYDGSRTQE--------EIVAKVREV--------SQPDW 168
            |.|:.:|.|.|:|||||.  .|....||:|.||.:        |:..||:.|        |....
  Fly    87 STLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSG 151

Mouse   169 TPPPEVTLSLTKDNFDD-VVNNADIILVEFYAPWTVALLLFSLSFYQFAVLLSTHTGLLDVNAND 232
            :...:..:.||:||||. |:|:.||.||||:||                                
  Fly   152 SSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAP-------------------------------- 184

Mouse   233 KSLMFQQFSVPVGPVLSFSPRRHSKIWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDL 297
                                      ||||||.||||:.||||||..:   :.|..:|||.....
  Fly   185 --------------------------WCGHCKNLAPEWAKAAKELKGK---VKLGALDATAHQSK 220

Mouse   298 AKRFDVSGYPTLKIFRKG--RPFD---YNGPREKYGIVDYMIEQ--SGPPSKEILTL--KQVQEF 353
            |..::|.||||:|.|..|  |..|   |:|.|....||.:..::  :..|:.|::.:  :...|.
  Fly   221 AAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFET 285

Mouse   354 LKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVSLG--------KLV 410
            ..:|..:.::.:.     |..|.......|     ||..|......||.:...|        :|.
  Fly   286 ACEGKPLCVVSVL-----PHILDCDAKCRN-----KFLDTLRTLGEKFKQKQWGWAWAEGGQQLA 340

Mouse   411 LTHPEKFQSKYEPRFHVMD--------VQGSTEASAIKDYVVK------HALPLVGHRKTSNDAK 461
            |....:......|...|::        ::||.....|.:::..      |..|:.|         
  Fly   341 LEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRG--------- 396

Mouse   462 RYSKRPLVVVYYSVD 476
              :|:|.:|   |||
  Fly   397 --AKKPAIV---SVD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdia4NP_001355685.1 pdi_dom 63..164 CDD:273454 45/119 (38%)
ER_PDI_fam 173..691 CDD:273457 81/336 (24%)
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 41/95 (43%)
PDI_a_P5 157..262 CDD:239299 52/165 (32%)
Thioredoxin_6 190..383 CDD:290560 51/205 (25%)
P5_C 271..400 CDD:239281 23/149 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.