DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN2 and Lsd-2

DIOPT Version :9

Sequence 1:XP_016869748.1 Gene:PLIN2 / 123 HGNCID:248 Length:445 Species:Homo sapiens
Sequence 2:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster


Alignment Length:295 Identity:68/295 - (23%)
Similarity:118/295 - (40%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     8 PQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQKL 72
            |....:.|::.||:|::.:|.....|...|.:    ..|.|.|....:...:.|:|:|.|.:.||
  Fly    35 PHLESLERIIKLPVVNAAWDKSQDVYGKVKGK----NRVFEWALTAAEDCVTRAVTTAAPFVTKL 95

Human    73 EPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVTTTVTGAKDSVASTITGV 137
            :..||..:....||:|::|.:.||:.....:|...||..|.              |.|...:..|
  Fly    96 DRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVI--------------DVVQPHLERV 146

Human   138 MDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENALTKSELLVEQYLPLTEEELEKE- 201
            : |.|.|........|.:.....|.||.::...|..:||:.....:|.|:|.|.|..|.::|:: 
  Fly   147 V-KFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVEEDN 210

Human   202 ----------AKKVEGFDL----VQKPSYYV--RLGSLSTKLHSRAYQQALSRVKEAKQ------ 244
                      .|..|. |:    .:.|..:.  .:|.||.|:..|.|:....::|:.::      
  Fly   211 DDKQNAVVQNGKSSEN-DMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQVQKGNINDY 274

Human   245 -KSQQTISQLHSTVHLIEFAR-KNVYSANQKIQDA 277
             .|.....:||..::.|..:. .||..:.....||
  Fly   275 LSSLIAALKLHQYINFINSSMGTNVEQSGGSSSDA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN2XP_016869748.1 Perilipin 6..395 CDD:281086 68/295 (23%)
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 62/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156952
Domainoid 1 1.000 64 1.000 Domainoid score I10228
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5366
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.