DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLIN2 and pqn-79

DIOPT Version :10

Sequence 1:XP_016869748.1 Gene:PLIN2 / 123 HGNCID:248 Length:445 Species:Homo sapiens
Sequence 2:NP_502875.1 Gene:pqn-79 / 190872 WormBaseID:WBGene00004160 Length:335 Species:Caenorhabditis elegans


Alignment Length:80 Identity:17/80 - (21%)
Similarity:30/80 - (37%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     6 VDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSVAMTSALPIIQ 70
            |.|.|.|::  :||.:|.     ......:.:.|.|.... |:..:|..:....|..       |
 Worm   142 VAPAPQVIS--LNLEVVP-----QCQQQCAPQCQQPSAPQ-CQQCQNTCQQYAPVCQ-------Q 191

Human    71 KLEPQIAVANTYACK 85
            :..||..:.:..||:
 Worm   192 QCTPQCTLPSAPACQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLIN2XP_016869748.1 Perilipin 5..406 CDD:460784 17/80 (21%)
pqn-79NP_502875.1 DUF1096 19..69 CDD:368941
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.