DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JDP2 and kay

DIOPT Version :9

Sequence 1:XP_016876460.1 Gene:JDP2 / 122953 HGNCID:17546 Length:206 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:97 Identity:37/97 - (38%)
Similarity:55/97 - (56%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   101 GKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELK 165
            |:||....:...|||::|..|||:||.||||||.::.::|..|..|.|:||.....::.:||.|.
  Fly   404 GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLT 468

Human   166 QERQQLILMLNRHRPTC-IVRTDSVKTPESEG 196
            ..:.||..:|..||.|| .:|:|.:......|
  Fly   469 NSKNQLEYLLATHRATCQKIRSDMLSVVTCNG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JDP2XP_016876460.1 None
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 24/60 (40%)
coiled coil 421..480 CDD:269869 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.