DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4L1 and or6at1

DIOPT Version :9

Sequence 1:NP_001004717.1 Gene:OR4L1 / 122742 HGNCID:15356 Length:312 Species:Homo sapiens
Sequence 2:XP_009293935.1 Gene:or6at1 / 30356 ZFINID:ZDB-GENE-990415-190 Length:345 Species:Danio rerio


Alignment Length:305 Identity:119/305 - (39%)
Similarity:174/305 - (57%) Gaps:21/305 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     5 NGSLVTEFILLGFFGRWELQIFFFVTFSLIYGATVMGNILIMVTVTCRSTLHSPLYFLLGNLSFL 69
            :|| |..|||.|...:..|.|||     .:|.:.:.||.:|:..|.....|.:|:||.|.||||.
Zfish    33 SGS-VEYFILDGLKDKIVLPIFF-----TVYVSVLSGNSMIIYLVRTDPKLDTPMYFFLHNLSFS 91

Human    70 DMCLSTATTPKMIIDLLTDHKTISVWGCVTQMFFMHFFGGAEMTLLIIMAFDRYVAICKPLHYRT 134
            |:..::.|.|||:...||..||||..||..|:.|:.:.|.....||..||||||||||.||.|.|
Zfish    92 DIVYTSVTIPKMLSVFLTGDKTISKTGCFMQIQFVLWMGLTGRGLLTAMAFDRYVAICNPLRYTT 156

Human   135 IMSHKLLKGFAILSWIIGFLHSISQIVLTMNLPFCGHNVINNIFCDLPLVIKLACIETYTLELFV 199
            ||:.||.......||..|.|..:..::....||:||.||:.::|||...|:.|||::|.....|.
Zfish   157 IMTRKLCVLLIFASWTYGALIVLPPVIWATQLPYCGPNVVKHMFCDHSSVLTLACVDTTRNSFFA 221

Human   200 IADS--GLLSFTCFILLLVSYIVILVSVPKKSSHGLSKALSTLSAHIIVVTLFFGPCIFIYVWPF 262
            :|.:  |||  ..|:|:|:||:.|..::.:.|.....||.:|..:|:|||.:.:....|:|:   
Zfish   222 LALALIGLL--LTFLLILISYVYIGKAMRRMSMAQKLKAGATCVSHLIVVFISYCSAFFVYI--- 281

Human   263 SSLASNK-------TLAVFYTVITPLLNPSIYTLRNKKMQEAIRK 300
             |...:|       .:|:.|:|:||||||.||:||||::|:|:::
Zfish   282 -SYRVSKFDPEVRIMIALLYSVLTPLLNPIIYSLRNKELQDAMKR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4L1NP_001004717.1 7tm_4 31..301 CDD:304433 108/279 (39%)
or6at1XP_009293935.1 7tm_4 53..328 CDD:304433 110/284 (39%)
7tm_1 63..312 CDD:278431 99/254 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.