DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4L1 and or70b1

DIOPT Version :9

Sequence 1:NP_001004717.1 Gene:OR4L1 / 122742 HGNCID:15356 Length:312 Species:Homo sapiens
Sequence 2:NP_571158.1 Gene:or70b1 / 30294 ZFINID:ZDB-GENE-990415-189 Length:316 Species:Danio rerio


Alignment Length:283 Identity:94/283 - (33%)
Similarity:152/283 - (53%) Gaps:7/283 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    28 FVTFSLIYGATVMGNILIMVTVTCRSTLHSPLYFLLGNLSFLDMCLSTATTPKMIIDLL--TDHK 90
            ||.|.|.|.|.::.||.|.:.:|...:||.|:|.|..||...|:..::...|::::|:|  ...:
Zfish    27 FVFFLLFYVAIMVLNIGIFIVITTHRSLHEPMYMLFCNLPINDILGNSIMVPRLLMDILKSPSQR 91

Human    91 TISVWGCVTQMFFMHFFGGAEMTLLIIMAFDRYVAICKPLHYRTIMSHKLLKGFAILSWIIGFLH 155
            .||...||.|.|..|.:|....|:|||||.|||||||.||.|:|||::|.:...:.|:|.|..|.
Zfish    92 YISYVECVVQAFSTHTYGTTSHTILIIMAIDRYVAICNPLRYQTIMTNKTVITLSALAWGIALLF 156

Human   156 SISQIVLTMNLPFCGHNVINNIFCDLPLVIKLACIETYTLELFVIADSGLLSFTCFILLLVSYI- 219
            ....|.||:.|..| ...|:|.|||...:.||:|.:.....|:.:..:.||..:....:.|:|| 
Zfish   157 ISILIGLTLRLSRC-RTFISNPFCDNASLFKLSCEDVTINNLYGLIYTVLLFGSSMGSIAVTYIK 220

Human   220 VILVSVPKKSSHGLSKALSTLSAHI-IVVTLFFGPCIFIYVWPFSSLASNKTLA-VFYTVITPLL 282
            :..|.:..||....|:||.|.|.|: :.:.:.....|.|.:..|.:.:..:.:| :.:.:|..:|
Zfish   221 ITAVCLVTKSKMLNSRALKTCSTHLSLYLIMLISGLIIIVLHRFPAYSDYRKIASLLFHIIPSIL 285

Human   283 NPSIYTLRNKKMQEA-IRKLRFQ 304
            ||.||.:::.:::.. |:.|.|:
Zfish   286 NPIIYGVQSSEVRHVLIQVLSFK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4L1NP_001004717.1 7tm_4 31..301 CDD:304433 90/275 (33%)
or70b1NP_571158.1 7tm_4 30..308 CDD:304433 91/278 (33%)
7tm_1 41..290 CDD:278431 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.