DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4L1 and LOC105948380

DIOPT Version :9

Sequence 1:NP_001004717.1 Gene:OR4L1 / 122742 HGNCID:15356 Length:312 Species:Homo sapiens
Sequence 2:XP_031749671.1 Gene:LOC105948380 / 105948380 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:296 Identity:114/296 - (38%)
Similarity:181/296 - (61%) Gaps:11/296 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    13 ILLGFFGRWELQIFFFVTFSLIYGATVMGNILIMVTVTCRSTLHSPLYFLLGNLSFLDMCLSTAT 77
            :|.||.....||:..|:.|.|||..|:.||:||::.:...|.||:|:||.||.|:.|||..|:.|
 Frog    26 LLCGFEVDPSLQLPLFLVFLLIYLITLTGNLLILLLIFTDSHLHTPMYFFLGTLACLDMSYSSVT 90

Human    78 TPKMIIDLLTDHKTISVWGCVTQMFFMHFFGGAEMTLLIIMAFDRYVAICKPLHYRTIMSH---- 138
            .|:|:.||||..:.|||..|:||::|..||..:||::|.:|::|||:|||:||||..|||.    
 Frog    91 VPRMLFDLLTGRRVISVQHCITQIYFFLFFAVSEMSVLAVMSYDRYIAICRPLHYMQIMSWEVCV 155

Human   139 KLLKGFAILSWIIGFLHSISQIVLTMNLPFCGHNVINNIFCDLPLVIKLACIETYTLELFVIADS 203
            :|:.|....:.|...||::....||    ||..:.:.:.|||||.:::::|.:|:...|.:....
 Frog   156 QLVSGILSFASIYTLLHTLFLAKLT----FCRPDALQSFFCDLPQLLQISCSDTFINVLLIFLSG 216

Human   204 GLLSFTCFILLLVSYIVILVSVPKKSSHGL-SKALSTLSAHIIVVTLFFGPCIFIYVWPFSS--L 265
            .|.......:::..||.|:.:|.|..|..: |||.||.|:|:.||.:|:...||.|..|.:.  |
 Frog   217 ILYGGVALSVIIFPYITIIRTVLKIPSKAMRSKAFSTCSSHLTVVFIFYSTIIFNYFRPNAKYHL 281

Human   266 ASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRKL 301
            ..:|..::||:.:||.|||.||:|||::::.::|::
 Frog   282 TEDKVASIFYSTLTPFLNPLIYSLRNQELKTSLRRM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4L1NP_001004717.1 7tm_4 31..301 CDD:304433 108/276 (39%)
LOC105948380XP_031749671.1 7tm_GPCRs 39..314 CDD:421689 108/278 (39%)
TM helix 1 39..65 CDD:410628 10/25 (40%)
TM helix 2 72..98 CDD:410628 12/25 (48%)
TM helix 3 110..140 CDD:410628 14/29 (48%)
TM helix 4 153..174 CDD:410628 5/20 (25%)
TM helix 5 208..238 CDD:410628 5/29 (17%)
TM helix 6 245..275 CDD:410628 13/29 (45%)
TM helix 7 282..307 CDD:410628 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.