DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ciita and CG8197

DIOPT Version :9

Sequence 1:NP_001289547.1 Gene:Ciita / 12265 MGIID:108445 Length:1155 Species:Mus musculus
Sequence 2:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster


Alignment Length:431 Identity:88/431 - (20%)
Similarity:139/431 - (32%) Gaps:146/431 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse   747 LAQCNEIKDKELPQYLALTPR--------------KKRPYDNWLEGVPRFLAGLVFQPRA----H 793
            |..| |...||.|...|...|              .||||..:.      ...|.|:.|.    |
  Fly     5 LLPC-EYNPKECPSPAAEKSRLFTILLLYCWQREYDKRPYRQFQ------FKRLTFEERIGRRYH 62

Mouse   794 CLGALVEPAVAAVADRKQKVLTRYLKR----------LKLGTLRAGRLLELLHCAHETQQPGIWE 848
            |:             |..:::..||.|          |.:....||.|.:.:    .:..| :|.
  Fly    63 CI-------------RDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDFV----RSLLP-VWY 109

Mouse   849 ------------------HVAHQLPGHLSFLGTRLTPPDVYVLG---------RALETAS---QD 883
                              :.|......||..||.||..||.:|.         |.|..:|   ..
  Fly   110 IELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQ 174

Mouse   884 FSLDL------RQTGVEPSGLGNLVGLSC------VTSFRASLSDTMALWESLQQQGEAQLLQAA 936
            |:..|      :..||.......|:|:|.      ::|..:||.....||               
  Fly   175 FNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLW--------------- 224

Mouse   937 EEKFTIEPFKAKSPKDVEDLDRLVQTQRLRNPSEDAAKDLPAIRDLKKLEFALGPILGPQAFPTL 1001
              ..::|..:..:...:...:.|.:|.                ...::|..|...| ||.....|
  Fly   225 --ALSLEHCELTAQDMIPIAEHLARTN----------------SKFRRLRIACNKI-GPDGAFFL 270

Mouse  1002 AKILPAFSSLQHLDLDSLSENKIGDKGVSKLSATFPQLKALETLNLSQNNITDVGACKLAEALPA 1066
            .:.:....:|:.|||...|....|.:.|:|..|:   .:.|:.|:|:.|   |:|...:...|.|
  Fly   271 LRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLAS---CRRLQVLHLNYN---DMGPTAVNLILLA 329

Mouse  1067 LAK--SLLRLSLYNNCICDKGAKSLAQVLPDMVSLRVMDVQ 1105
            :.|  .|.:|:||.|....:.|         |:..|::|.:
  Fly   330 MKKQCKLEKLTLYGNHFDSRTA---------MIVRRLLDAE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CiitaNP_001289547.1 Required for acetyltransferase activity. /evidence=ECO:0000250 171..210
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..357
NACHT 440..609 CDD:283404
LRR_RI 814..1139 CDD:238064 70/346 (20%)
leucine-rich repeat 982..1008 CDD:275381 6/25 (24%)
LRR 1 1010..1033 8/22 (36%)
leucine-rich repeat 1011..1041 CDD:275380 9/29 (31%)
LRR 2 1041..1062 6/20 (30%)
leucine-rich repeat 1042..1070 CDD:275380 9/29 (31%)
LRR 3 1070..1091 6/20 (30%)
leucine-rich repeat 1071..1098 CDD:275380 7/26 (27%)
LRR 4 1098..1119 2/8 (25%)
leucine-rich repeat 1099..1126 CDD:275380 2/7 (29%)
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 9/26 (35%)
LRR_RI 137..374 CDD:238064 60/274 (22%)
leucine-rich repeat 162..189 CDD:275381 5/26 (19%)
leucine-rich repeat 202..220 CDD:275380 4/17 (24%)
leucine-rich repeat 223..251 CDD:275380 5/60 (8%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 9/29 (31%)
leucine-rich repeat 308..335 CDD:275380 9/29 (31%)
leucine-rich repeat 336..357 CDD:275380 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.