DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Btk and wnd

DIOPT Version :9

Sequence 1:NP_038510.2 Gene:Btk / 12229 MGIID:88216 Length:659 Species:Mus musculus
Sequence 2:NP_649137.3 Gene:wnd / 40143 FlyBaseID:FBgn0036896 Length:977 Species:Drosophila melanogaster


Alignment Length:266 Identity:89/266 - (33%)
Similarity:144/266 - (54%) Gaps:15/266 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse   395 WEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQ 459
            |:|..:.:|.|:.||:|..|.|..|:.:.: .||:|.::|  :.|.:.    |.:..|.||.:::
  Fly   154 WQIPFESITELEWLGSGAQGAVFSGRLKNE-TVAVKKVKE--LKETDI----KHLRKLDHENIIK 211

Mouse   460 LYGVCTKQRPIF-IITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLA 523
            ..|||| |.|:| ||.|:...|.|.|.|:|.:....: :|:...|.:...|:||.|.:.:||||.
  Fly   212 FKGVCT-QSPVFCIIMEFCPYGPLQNILKEEQVMLPS-RLVSWSKQIALGMQYLHSHKIIHRDLK 274

Mouse   524 ARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMW 588
            :.|.|::...|||:||||.||..  :|.::.:.....|.|..|||:.....|.|.|||::||::|
  Fly   275 SPNILISTNEVVKISDFGTSREW--NEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLW 337

Mouse   589 EIYSLGKMPYERFTNSETAEHIA-QGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNIL 652
            |:.:. ::||:...:|.....:. ..|:|..|....|....::..||..|...||||:.:||: |
  Fly   338 EMLTC-EIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSH-L 400

Mouse   653 DVMDEE 658
            |:...|
  Fly   401 DIAGPE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BtkNP_038510.2 PH_Btk 6..166 CDD:269944
Inositol-(1,3,4,5)-tetrakisphosphate 1-binding. /evidence=ECO:0000250 12..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..210
SH3_BTK 217..271 CDD:212839
SH2_Tec_Btk 274..378 CDD:198260
PTKc_Btk_Bmx 397..652 CDD:173657 85/256 (33%)
Inhibitor-binding. /evidence=ECO:0000250 474..479 1/4 (25%)
CAV1-binding. /evidence=ECO:0000250 581..588 3/6 (50%)
wndNP_649137.3 STYKc 161..400 CDD:214568 84/251 (33%)
STKc_MAP3K12_13 167..403 CDD:270961 84/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.