DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and bdl

DIOPT Version :10

Sequence 1:NP_033898.1 Gene:Bsg / 12215 MGIID:88208 Length:389 Species:Mus musculus
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:405 Identity:90/405 - (22%)
Similarity:149/405 - (36%) Gaps:94/405 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 AALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCE---AVGSPIPEIQWWFEGN--- 61
            :|||..||..||......:||...:...:.|...|..||.:|.   ...:|||.:..|.:.|   
  Fly    14 SALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYLVHWTKDNKKI 78

Mouse    62 ----APNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRP 122
                ....|.|:|::|    |:|:...:.:...:|:::..:...|.|.|.|:.|. |:|:...|.
  Fly    79 FTWYEQETSTSELFNG----RLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSF-PNRSPSVRN 138

Mouse   123 PRVKW-VRAQASVVVLEPGTIQTSVQEVNSKTQLTCSL----NSSGVDIVGHRWMRGGKVLQEDT 182
            ....: :..|...::..|...|| ::| .......|.:    ||..      .|.:.|.:|||  
  Fly   139 NGTAYHLAVQGGSLIRIPPVNQT-IRE-GQTAFFHCVMKHPENSQA------SWYKDGVLLQE-- 193

Mouse   183 LPDLHTKYIVDAD----------DRSGEYSCIFLPEPVGRSE---------INVEGPPRIKVGKK 228
            :.||..::.:..|          ...|||.|     .|..|:         :|::...::.....
  Fly   194 VQDLVRRFYMGPDGSLSIDPTMMSDLGEYEC-----KVRNSDGELQTAKAFLNIQYKAKVIYAPP 253

Mouse   229 SEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISN 293
            ......|:.|.|.|...|: ||:.:..|.|      :..:.:|....|.:..::    ..|..:.
  Fly   254 EVFLPYGQPAVLDCHFRAN-PPLKNLRWEK------DGLLFDSYNVPGVFYKMN----GSLFFAK 307

Mouse   294 LDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIF------IY--- 349
            :|.| ..|:|.|...|..||...:             |    |..|:||...||      ||   
  Fly   308 VDEN-HAGSYTCTPYNDLGTDGPS-------------P----VISVIVLRPPIFSVTPKAIYIQK 354

Mouse   350 --EKRRKPDQTLDED 362
              |....|.:.:|.|
  Fly   355 LGEAAELPCEAIDRD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_033898.1 Ig 23..138 CDD:472250 27/125 (22%)
Ig strand B 40..44 CDD:409534 2/3 (67%)
Ig strand C 53..57 CDD:409534 0/3 (0%)
Ig strand E 91..95 CDD:409534 1/3 (33%)
Ig strand F 105..110 CDD:409534 2/4 (50%)
Ig strand G 129..132 CDD:409534 0/2 (0%)
IG_like 233..322 CDD:214653 20/88 (23%)
Ig strand B 237..242 CDD:409436 2/4 (50%)
Ig strand C 251..259 CDD:409436 1/7 (14%)
Ig strand E 277..281 CDD:409436 0/3 (0%)
Ig strand F 302..307 CDD:409436 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..389 2/7 (29%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 21/89 (24%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 1/3 (33%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 21/103 (20%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 0/9 (0%)
Ig strand E 207..211 CDD:409544 0/3 (0%)
Ig strand F 221..226 CDD:409544 3/9 (33%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 17/86 (20%)
Ig 341..428 CDD:472250 8/29 (28%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353
Ig strand E 396..400 CDD:409353
Ig strand F 410..415 CDD:409353
Ig strand G 423..426 CDD:409353
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.