DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmp2 and scw

DIOPT Version :9

Sequence 1:NP_031579.2 Gene:Bmp2 / 12156 MGIID:88177 Length:394 Species:Mus musculus
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:170/421 - (40%) Gaps:121/421 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    39 RPLSRPSE--DVL------------------SEFELRLLSMFGLKQRPTPSKDVVVPPYMLDLYR 83
            ||||...|  |:|                  |:|.|.:.:.....|.|   |:|        |::
  Fly    34 RPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEP---KEV--------LHQ 87

Mouse    84 RHSGQPGAP---APDHRLERAASRANTVRSFHHEEAVEELPEMSGKTARRFFFNLSSVPSDEFLT 145
            ||.......   :.:.|.|.|:  .|::.:|......|:|   ..:......||.:.||.|..|.
  Fly    88 RHKRSLDDDILISNEDRQEIAS--CNSILTFSSRLKPEQL---DNELDMHITFNTNDVPVDLSLV 147

Mouse   146 SAELQIFREQIQEALGNSSFQHRINIYEIIKPAAANLKFPVTRLLDTR---------LVNQNTSQ 201
            .|.|:|:::.       |....|           ||....|.|.||.|         .||..:||
  Fly   148 QAMLRIYKQP-------SLVDRR-----------ANFTVSVYRKLDNRQDFSYRILGSVNTTSSQ 194

Mouse   202 --WESFDVTPAVMRWTTQGHTNHGFVVEVAHLEENPGVSKRH-VRIS----------RSLHQDEH 253
              |..|::|..:..|.                 .|.|:.:|: :|||          ..|...:.
  Fly   195 RGWLEFNLTDTLRYWL-----------------HNKGLQRRNELRISIGDSQLSTFAAGLVTPQA 242

Mouse   254 SWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRL-------------------KSSCKRHPL 299
            |.:.:.|.:|  |:......|.|.:|.:.|....||.                   ..||:|...
  Fly   243 SRTSLEPFIV--GYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNF 305

Mouse   300 YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTEL 364
            .|||.::..::|::||..:.|::|.|.|.|||...:|:|||||||||::.....:||.|||||.|
  Fly   306 TVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVL 370

Mouse   365 SAISML-YLDENEKVV-LKNYQDMVVEGCGC 393
            .||::| ||  ||.:: |..||..|.:.|||
  Fly   371 GAITILRYL--NEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bmp2NP_031579.2 TGFb_propeptide 43..265 CDD:279078 56/266 (21%)
TGFB 294..394 CDD:214556 47/102 (46%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 56/267 (21%)
TGFB 300..400 CDD:214556 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X157
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.