DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL4 and tap

DIOPT Version :10

Sequence 1:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens
Sequence 2:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster


Alignment Length:54 Identity:22/54 - (40%)
Similarity:35/54 - (64%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    76 KRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLE 129
            |.|:|||.|:..:|:...:||..||....:.:|:|:|.||.|.:||..|:::||
  Fly   158 KANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:469605 20/52 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172
tapNP_524124.1 bHLH_TS_NGN 155..211 CDD:381434 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.