DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL4 and amos

DIOPT Version :10

Sequence 1:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:68 Identity:29/68 - (42%)
Similarity:40/68 - (58%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    67 SAFEPAFLRKR----NERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQEL 127
            :.|....|:||    |.|||:|:..:|:.:.:|||.:|....|:||||.|||:.|..||..|..|
  Fly   129 AGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTL 193

Human   128 LER 130
            |.|
  Fly   194 LSR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:469605 27/65 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 26/62 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.