DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL4 and HLH3B

DIOPT Version :10

Sequence 1:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:58 Identity:29/58 - (50%)
Similarity:36/58 - (62%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    78 NERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLE---RQA 132
            |.|||.|.:.|:..:|.||..:|....||:|||.|.||:||.|||.|..:||   |||
  Fly   171 NTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILEWQQRQA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:469605 24/50 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172
HLH3BNP_525055.1 bHLH_TS_dHLH3B_like 166..225 CDD:381551 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.