DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ASCL4 and Fer1

DIOPT Version :10

Sequence 1:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:59 Identity:27/59 - (45%)
Similarity:40/59 - (67%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    78 NERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIDYIKHLQELLERQAWGLE 136
            |.|||:|::.:||.:..||.|:|....:||||||:||:.||.||..|.|::::...|.|
  Fly    92 NLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:469605 25/50 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.