| Sequence 1: | NP_001107648.1 | Gene: | AEBP2 / 121536 | HGNCID: | 24051 | Length: | 517 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011581.4 | Gene: | YGR067C / 852958 | SGDID: | S000003299 | Length: | 804 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 217 | Identity: | 40/217 - (18%) |
|---|---|---|---|
| Similarity: | 68/217 - (31%) | Gaps: | 95/217 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Human 317 RHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPT------------------------------ 351
Human 352 --------------------------HFSQQNSSKVSSQPK---AKEESPSKAGMNKRRKLKNKR 387
Human 388 RRSLPRPHDFFDAQTLDAIRHRAIC--FNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLH 450
Human 451 WMP--------EDILPDVWVNE 464 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AEBP2 | NP_001107648.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..229 | ||
| Interaction with RBBP4 | 209..294 | ||||
| COG5048 | <215..>339 | CDD:227381 | 10/21 (48%) | ||
| C2H2 Zn finger | 266..286 | CDD:275368 | |||
| C2H2 Zn finger | 297..322 | CDD:275368 | 2/4 (50%) | ||
| C2H2 Zn finger | 330..352 | CDD:275368 | 9/77 (12%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 352..394 | 11/44 (25%) | |||
| Interaction with SUZ12. /evidence=ECO:0000269|PubMed:29499137 | 407..478 | 10/68 (15%) | |||
| Important for nucleosome binding activity of the PRC2 complex. /evidence=ECO:0000269|PubMed:29499137 | 495..517 | ||||
| YGR067C | NP_011581.4 | C2H2 Zn finger | 10..30 | CDD:275368 | 2/4 (50%) |
| zf-C2H2 | 36..57 | CDD:395048 | 9/22 (41%) | ||
| C2H2 Zn finger | 38..57 | CDD:275368 | 8/20 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||