DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AEBP2 and B0310.2

DIOPT Version :10

Sequence 1:NP_001107648.1 Gene:AEBP2 / 121536 HGNCID:24051 Length:517 Species:Homo sapiens
Sequence 2:NP_508109.1 Gene:B0310.2 / 180403 WormBaseID:WBGene00015138 Length:413 Species:Caenorhabditis elegans


Alignment Length:143 Identity:33/143 - (23%)
Similarity:54/143 - (37%) Gaps:31/143 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   215 PLSRMDSEDSISSTIMDVDS-----TISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNS 274
            |:|...:|.......:||:|     .:|...||..:...:.|::|:...|:.||....|..   .
 Worm   242 PVSNHFTESDAEDIKIDVESDEGEIEVSPSPSTGDITENESSSSSTGPMISPNCGDGDCAL---E 303

Human   275 SPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASF 339
            .|                  |:|:...|   .....::..|::||..|:|.:|..|  ..|:..|
 Worm   304 KP------------------FICMHNNC---GKRFANKFLLKKHMFIHTGLRPHTC--PHCHKKF 345

Human   340 ASQGGLARHVPTH 352
            ..:..|.||..||
 Worm   346 NRKDNLLRHKKTH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AEBP2NP_001107648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..229 3/13 (23%)
Interaction with RBBP4 209..294 16/83 (19%)
COG5048 <215..>339 CDD:227381 27/128 (21%)
C2H2 Zn finger 266..286 CDD:275368 2/19 (11%)
C2H2 Zn finger 297..322 CDD:275368 5/24 (21%)
C2H2 Zn finger 330..352 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..394 1/1 (100%)
Interaction with SUZ12. /evidence=ECO:0000269|PubMed:29499137 407..478
Important for nucleosome binding activity of the PRC2 complex. /evidence=ECO:0000269|PubMed:29499137 495..517
B0310.2NP_508109.1 C2H2 Zn finger 308..330 CDD:275368 5/24 (21%)
zf-H2C2_2 323..347 CDD:463886 9/25 (36%)
C2H2 Zn finger 338..358 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.