DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmp1 and CG15253

DIOPT Version :10

Sequence 1:NP_033885.2 Gene:Bmp1 / 12153 MGIID:88176 Length:991 Species:Mus musculus
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:248 Identity:85/248 - (34%)
Similarity:115/248 - (46%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    89 PSIKAAGNSSALGG--QGTSGQPQRESRGRWRGRPRSRRAATSRPERVWPDGVIPFVIGGNFTGS 151
            |||:...:.....|  :|.. .|...||..||..       |.|    ||:.:|.:.|.......
  Fly    21 PSIRIETDPELTAGYIEGDM-VPSGSSRNIWRNE-------TYR----WPNRIIYYHINSYIDEE 73

Mouse   152 QRAVFRQAMRHWEKHTCVTFLE-RTDEDSYIVFTYRPCGCCSYVGRRGG----GPQAISIGKNCD 211
            .|.....|::..|..:|:||.| .||:..|:..|....||.||:|....    ..|...||..|.
  Fly    74 HRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCF 138

Mouse   212 KFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMH 276
            :...:|||..|.:||:|:.:..|||.:|.||.|||..|.|:||.|...:.|...||.||:.|:||
  Fly   139 RLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMH 203

Mouse   277 YARNTFSRGIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCPACGE 329
            |....||:. ...||:...|  |.:..||||..||:.||.:...:||||...|
  Fly   204 YGPYAFSKN-GERTILALEE--GKEDVIGQRLELSETDIRKLNAIYKCPTVKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bmp1NP_033885.2 ZnMc_BMP1_TLD 126..325 CDD:239808 72/203 (35%)
CUB 327..436 CDD:395345 1/3 (33%)
CUB 440..549 CDD:395345
FXa_inhibition 560..592 CDD:464251
CUB 596..705 CDD:395345
FXa_inhibition 712..747 CDD:464251
CUB 752..861 CDD:395345
CUB 865..978 CDD:395345
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.