DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmp1 and CG15253

DIOPT Version :9

Sequence 1:NP_001346950.1 Gene:Bmp1 / 12153 MGIID:88176 Length:991 Species:Mus musculus
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:248 Identity:85/248 - (34%)
Similarity:115/248 - (46%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    89 PSIKAAGNSSALGG--QGTSGQPQRESRGRWRGRPRSRRAATSRPERVWPDGVIPFVIGGNFTGS 151
            |||:...:.....|  :|.. .|...||..||..       |.|    ||:.:|.:.|.......
  Fly    21 PSIRIETDPELTAGYIEGDM-VPSGSSRNIWRNE-------TYR----WPNRIIYYHINSYIDEE 73

Mouse   152 QRAVFRQAMRHWEKHTCVTFLE-RTDEDSYIVFTYRPCGCCSYVGRRGG----GPQAISIGKNCD 211
            .|.....|::..|..:|:||.| .||:..|:..|....||.||:|....    ..|...||..|.
  Fly    74 HRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCF 138

Mouse   212 KFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMH 276
            :...:|||..|.:||:|:.:..|||.:|.||.|||..|.|:||.|...:.|...||.||:.|:||
  Fly   139 RLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMH 203

Mouse   277 YARNTFSRGIFLDTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCPACGE 329
            |....||:. ...||:...|  |.:..||||..||:.||.:...:||||...|
  Fly   204 YGPYAFSKN-GERTILALEE--GKEDVIGQRLELSETDIRKLNAIYKCPTVKE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bmp1NP_001346950.1 ZnMc_BMP1_TLD 126..325 CDD:239808 72/203 (35%)
CUB 327..436 CDD:278839 1/3 (33%)
CUB 440..549 CDD:278839
FXa_inhibition 560..592 CDD:317114
CUB 596..705 CDD:278839
FXa_inhibition 712..747 CDD:317114
CUB 752..861 CDD:278839
CUB 865..978 CDD:278839
CG15253NP_609758.1 Astacin 55..250 CDD:279708 72/201 (36%)
ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.