DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmi1 and l(3)73Ah

DIOPT Version :9

Sequence 1:NP_031578.2 Gene:Bmi1 / 12151 MGIID:88174 Length:324 Species:Mus musculus
Sequence 2:NP_001246797.1 Gene:l(3)73Ah / 48903 FlyBaseID:FBgn0002283 Length:222 Species:Drosophila melanogaster


Alignment Length:230 Identity:94/230 - (40%)
Similarity:134/230 - (58%) Gaps:23/230 - (10%)


- Green bases have known domain annotations that are detailed below.


Mouse     6 RIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIR 70
            |:|:..:|||:.|.:||||||||||:.||||:|||:|:|::||..|.||.||..:|::.||..|.
  Fly     4 RVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTCDNIIHQSHPLQYIS 68

Mouse    71 SDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH--PSADAANGSNEDRGEVADEEKRIITDDEIISL 133
            .|:|:|||||||||.|.::|.:|.||||.:.  |.......::||     |.||  :.|....| 
  Fly    69 FDRTMQDIVYKLVPKLQEDESRRERDFYKSRNMPCPKDITQNHED-----DNEK--VMDAHAES- 125

Mouse   134 SIEFFDQSRLDRKVNKEKPKEEVN----DKRYLRCPAAMTVMHLRKFLRSKM--DIPNTFQIDVM 192
                 |..|||.:||........|    .:|::||.:..|:.||:|.:..|:  .|....:||::
  Fly   126 -----DFHRLDEQVNVCLECISNNFKNLQRRFIRCSSQATITHLKKLVAKKILNGIEKYREIDIL 185

Mouse   193 YEEEPLKDYYTLMDIAYIYTWR-RNGPLPLKYRVR 226
            ..||.|...:|| ...|:..|| |:.||.|::|.|
  Fly   186 CNEELLGKDHTL-KFVYVTRWRFRDPPLRLQFRPR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bmi1NP_031578.2 rad18 8..>132 CDD:273165 60/125 (48%)
RING-HC_PCGF4 12..65 CDD:319650 31/52 (60%)
Nuclear localization signal. /evidence=ECO:0000255 81..95 7/13 (54%)
RAWUL_PCGF4 130..224 CDD:340685 31/100 (31%)
Interaction with PHC2. /evidence=ECO:0000250|UniProtKB:P35226 160..180 7/19 (37%)
Interaction with E4F1. /evidence=ECO:0000250|UniProtKB:P35226 162..226 23/66 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..324
l(3)73AhNP_001246797.1 RING-HC_PCGF3 13..59 CDD:319649 28/45 (62%)
RAWUL_PCGF3 133..217 CDD:340603 26/84 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S517
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000290
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.