DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERP27 and CG14695

DIOPT Version :10

Sequence 1:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens
Sequence 2:NP_650032.1 Gene:CG14695 / 41314 FlyBaseID:FBgn0037850 Length:289 Species:Drosophila melanogaster


Alignment Length:161 Identity:29/161 - (18%)
Similarity:54/161 - (33%) Gaps:64/161 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   136 IEINSLHMVTEYNPVTVI------GLFN----SVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQ 190
            |:.||:..:....|:|.:      |.|.    .|:..|  .:.|:.....::.:....:.|:.:.
  Fly     9 IDNNSIPWILWLPPLTEVDRKSPGGRFTFDGPKVVAFH--FVKNRHGDTLDKWISLLDELAQEYA 71

Human   191 GKILFILVD-SGMKE--------------------------NGKVISFFKLKESQLPALAIYQTL 228
            |:|||.|.| |.:.|                          .|:|....||              
  Fly    72 GRILFGLRDISNIGEFNPNLNPDDFGSYRKGLPPRIYGKDCEGRVYDMHKL-------------- 122

Human   229 DDEWDTLPTAEVSVEHVQNFCDGFLSGKLLK 259
                       |:.::::.|||..|:.:|.:
  Fly   123 -----------VNAKYLREFCDQLLADQLFR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999 25/150 (17%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
CG14695NP_650032.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.