DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERP27 and Pdi

DIOPT Version :10

Sequence 1:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens
Sequence 2:NP_524079.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster


Alignment Length:42 Identity:10/42 - (23%)
Similarity:21/42 - (50%) Gaps:6/42 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   649 KPRPKRTCIVDGKKLRIGEY------KQLMRSRRQEMRQFFT 684
            ||.|:...::.|..:.:|.:      |::.:...:.||.|:|
  Fly   493 KPMPRGEIVIGGSNITLGYFKNEEKTKEVYKVDEKGMRWFYT 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
PdiNP_524079.1 ER_PDI_fam 27..474 CDD:273457
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.