DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERP27 and prtp

DIOPT Version :10

Sequence 1:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens
Sequence 2:NP_572742.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:243 Identity:50/243 - (20%)
Similarity:80/243 - (32%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    58 VAVIGFFQDLEIPAVPILHSMVQKFPG---VSFGISTDSEVLTHYNITGNTICLF---------R 110
            |||.|.   |..|.:||..:..::..|   ..|.:..|.|........||....|         |
  Fly     9 VAVCGL---LLSPLLPITRASQEEDTGKQDKQFTVELDPETFDTAIAGGNVFVKFFAPWCGHCKR 70

Human   111 L------------VDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGL-------F 156
            :            |||.::     .|..:|.||..   .:.:.|.||.|..:.:..|       |
  Fly    71 IQPLWEQLAEIMNVDNPKV-----IIAKVDCTKHQ---GLCATHQVTGYPTLRLFKLGEEESVKF 127

Human   157 NSVIQIHLLL-IMNK---ASPEYEENMHRYQKAAKLFQGKILFILVDSGMKE---NGKVISFFKL 214
            .....:..:. .:||   |..|.:....:.::...|..||::.:..|:..|.   ....:.||  
  Fly   128 KGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIGKVVDLTEDTFAKHVSTGNHFVKFF-- 190

Human   215 KESQLPALAIYQTLDDEWDTL-------PTAEVS---VEHVQNFCDGF 252
                .|..:..|.|...|:.|       ||..:|   ....::.|..|
  Fly   191 ----APWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSICQDF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999 44/233 (19%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
prtpNP_572742.1 PDI_a_ERp46 38..140 CDD:239303 20/109 (18%)
PDI_a_ERp46 167..267 CDD:239303 15/74 (20%)
PDI_a_ERp46 303..407 CDD:239303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.