DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CMA1 and CG18420

DIOPT Version :9

Sequence 1:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:297 Identity:79/297 - (26%)
Similarity:113/297 - (38%) Gaps:96/297 - (32%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLLLPLPLLLFLLCSRAEAG---------EIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLI 56
            :||...|||.......:|.|         .|:.|.....:|.|:||:|. .:||  ...|||.||
  Fly    13 LLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLH-TSSN--QFICGGTLI 74

Human    57 RRNFVLTAAHC--AGRSITVTLGAHN-----ITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLL 114
            .|..|||||||  ...:|.|.||.:|     ..||.      :|.:.|:|..|:.:|..:||.||
  Fly    75 SRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEH------QVNRTFQHRFYDPNTHANDIALL 133

Human   115 KLKEKA----------------------SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKP 157
            :|....                      |:.:..||                   |||||..:..
  Fly   134 RLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGT-------------------GWGRTESMHD 179

Human   158 GSDTLQEVKLRLMD----PQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPL----------- 207
            .|:      ||.:|    |.....|.....| |.|.||  ...:...||:|||:           
  Fly   180 SSE------LRTLDISRQPSKMCAFGSVLSN-QFCAGN--WNSNLCIGDTGGPVGAMVRYRNAFR 235

Human   208 -LCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQI 243
             :..|:|   ::..|  .:.|:|||.:..:..:|.:|
  Fly   236 FVQVGIA---ITNKR--CQRPSVFTDVMSHIEFIRRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 71/265 (27%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 70/263 (27%)
Tryp_SPc 43..267 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.