DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GTSF1 and CG32625

DIOPT Version :9

Sequence 1:NP_653195.2 Gene:GTSF1 / 121355 HGNCID:26565 Length:167 Species:Homo sapiens
Sequence 2:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster


Alignment Length:111 Identity:34/111 - (30%)
Similarity:50/111 - (45%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     8 SLDPE--KLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISS 70
            |.||:  :.:.||...:|.:...:.||||..|.|..|  :.:||.||:|..|..|.|:|..||..
  Fly     2 SADPKLYEYVNCPNSSSHLVMLFKMPYHLPLCAKKFP--SDELARCPYNRTHMYPIADIYEHIIK 64

Human    71 CDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCD------EDWDKD 110
            |..             .||:|:.:::......||      :|||.|
  Fly    65 CPS-------------YLREESHSDAKEDAKDCDAKESDAKDWDAD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GTSF1NP_653195.2 zf-U11-48K 15..38 CDD:398771 7/22 (32%)
zf-U11-48K 49..71 CDD:398771 10/21 (48%)
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40293
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21402
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.