DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLTB and Clc

DIOPT Version :10

Sequence 1:NP_009028.1 Gene:CLTB / 1212 HGNCID:2091 Length:229 Species:Homo sapiens
Sequence 2:NP_524178.2 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster


Alignment Length:96 Identity:23/96 - (23%)
Similarity:37/96 - (38%) Gaps:29/96 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    19 AVFQRAGPAMAS---------------VPWLPRLAERWLPARPATCLTPS--LTRGLHHGPQPEE 66
            |.||:..||..|               || :|...:..:||.|.:.:.||  :.:.::..|....
  Fly   729 ATFQQNWPAAGSTLVNSAQGVSGTPPCVP-IPAPGQPAVPATPTSQIPPSPFVQQPIYPPPNSSW 792

Human    67 RT------AGDA-----RLQPGPADHIGAKF 86
            .|      :|||     ::|..||..:...|
  Fly   793 DTRSLISPSGDAVATSSQMQGPPAQQVSGPF 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLTBNP_009028.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 22/90 (24%)
Clathrin_lg_ch 3..225 CDD:460056 23/96 (24%)
Involved in binding clathrin heavy chain 93..155
ClcNP_524178.2 Clathrin_lg_ch 11..211 CDD:460056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.