DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLTA and Clc

DIOPT Version :10

Sequence 1:NP_009027.1 Gene:CLTA / 1211 HGNCID:2090 Length:248 Species:Homo sapiens
Sequence 2:NP_524178.2 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster


Alignment Length:229 Identity:49/229 - (21%)
Similarity:73/229 - (31%) Gaps:71/229 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    49 GEDSAFQEPDSPLPSARSPAEAEAERRRRSPGAEPSSPGELEDDLLLQGGGGGAQAAGGGAEGDS 113
            ||.|.|.......|.......:..||..:.|   |||.         |..|.|...         
  Fly   669 GEKSKFHLASINRPLPHEDGGSHPERHLQVP---PSSK---------QDSGSGEYV--------- 712

Human   114 WEEEGFGSSSPVKS---------PSTAYFLSSPFSPVRCGGPGDASPQG-CGAPRAMDDPCSPQP 168
                     ||:.|         |...:..:.|    ..|.....|.|| .|.|..:..|...||
  Fly   713 ---------SPLMSTDNHCNSVPPGATFQQNWP----AAGSTLVNSAQGVSGTPPCVPIPAPGQP 764

Human   169 DYPSTP----PHKTFRKLRLFDTPHT---PKSLLSKARVIDSGSVKLRGSSLFMDTEKSGKREFD 226
            ..|:||    |...|.:..::..|::   .:||:|.:           |.::...::..|.    
  Fly   765 AVPATPTSQIPPSPFVQQPIYPPPNSSWDTRSLISPS-----------GDAVATSSQMQGP---- 814

Human   227 TRQTPQVNINPFTPDPVLLHSSGRCRGRKRAYFN 260
              ...||: .||.|.||  |...:.:|.:...|:
  Fly   815 --PAQQVS-GPFMPPPV--HPVSQPQGPQVQQFD 843

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLTANP_009027.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 11/42 (26%)
Clathrin_lg_ch 22..248 CDD:460056 47/215 (22%)
Involved in binding clathrin heavy chain 100..162 12/71 (17%)
ClcNP_524178.2 Clathrin_lg_ch 11..211 CDD:460056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.