DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRK2 and CG31183

DIOPT Version :9

Sequence 1:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:443 Identity:104/443 - (23%)
Similarity:178/443 - (40%) Gaps:113/443 - (25%)


- Green bases have known domain annotations that are detailed below.


Human  1824 KILLDDLMKK--AEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLG 1886
            |:.|:|:|.:  ||.|   :......|....||:.  |:..|:   :.:|.|.       :..:.
  Fly   564 KVSLEDVMFRDAAERG---LRGSFHSLVKQSSQLT--LMSEDM---VSINGDR-------QIFIP 613

Human  1887 DGSFGSVYRAAYEGEEVAVK---IFNKHTSL-RLLRQELVVLCHLHHPSLISLLAAGI--RPRML 1945
            .|.|        ...:||:|   :.|....| |.|..||..:..|.|..|:....|.:  |...|
  Fly   614 VGMF--------RKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFL 670

Human  1946 VMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPH-NVLLFTLYPNA 2009
            :.|...||||..:|:.::..|....:..:...:..|:::|||:     |::.| |:.......::
  Fly   671 LTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSS-----DIRSHGNLKSSNCVVDS 730

Human  2010 AIIAKIADYGI-AQYCCRMGIKTSEGTPG---------FRAPEVARGNVIYN------QQADVYS 2058
            ..:.||.|:|: .....|..:::..|...         :.|||:.|  |.:|      |:.|||:
  Fly   731 RFVLKITDFGLHTLRRTRFDLESDGGNCNSHAYWSKLLWTAPELLR--VEHNRPPEGTQKGDVYA 793

Human  2059 FGLLLYDILTTGGRIVEGL----KFPNEFDELEIQGKLPDPVKEYGCAPW-PMVEK--------- 2109
            ||:::::|.|..|....|.    |.|.|..|| ::|..|..:::    |: |.:|.         
  Fly   794 FGIIVHEITTRQGPFYLGRCAYEKSPQEIIEL-VKGYNPHRMQK----PFRPELEPNGDTKADIN 853

Human  2110 -LIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGH 2173
             :|::|..|:|.|||.    |:.|.|     :.||.                |..|.:     |:
  Fly   854 GIIRRCWAEDPAERPD----FNTLKS-----MIRRF----------------NKDNET-----GN 888

Human  2174 TDRGQLSFLDL---NTEGYTSEEVAD---SRILCLALVH--LPVEKESWIVSG 2218
            .....|..::|   |.|....|...|   .:..|..|::  ||....:.::||
  Fly   889 IVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISG 941

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150
leucine-rich repeat 1131..1174 CDD:275380
LRR 8 1174..1196
leucine-rich repeat 1175..1197 CDD:275380
LRR 9 1197..1218
leucine-rich repeat 1198..1221 CDD:275380
LRR 10 1221..1241
leucine-rich repeat 1222..1246 CDD:275380
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970 72/288 (25%)
WD 1 2139..2183 6/43 (14%)
WD 2 2188..2228 8/36 (22%)
WD 3 2233..2276
WD 4 2281..2327
WD 5 2333..2377
WD 6 2402..2438
WD 7 2443..2497
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944 82/350 (23%)
Pkinase_Tyr 613..877 CDD:285015 73/292 (25%)
HNOBA <893..938 CDD:285003 10/44 (23%)
CYCc 917..1108 CDD:214485 6/25 (24%)
Guanylate_cyc 944..1130 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.