DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRK2 and Ac76E

DIOPT Version :9

Sequence 1:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:749 Identity:141/749 - (18%)
Similarity:251/749 - (33%) Gaps:248/749 - (33%)


- Green bases have known domain annotations that are detailed below.


Human  1823 QKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGD 1887
            |::.|:  .::.::..||::            :.|..|.|::.|:|||.             :.|
  Fly   252 QRVKLE--CEREQQEQLLLS------------VIPAYIAAEVKRSIMLK-------------MAD 289

Human  1888 G---SFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMEL 1949
            .   :.|....:|....|:.|:   :||::.:|..::|...    |...||.|:.     ||..|
  Fly   290 ACQRAGGQASTSATRFHELHVQ---RHTNVTILFADIVNFT----PLSSSLTASD-----LVKTL 342

Human  1950 ASK-GSLDRLLQQDKASLTRTL---------------QH-----RIALHVADGLRYLHSAMIIYR 1993
            ... |..|::.|:::....:.|               ||     .:.|.:.|.:|::..|..|..
  Fly   343 NDLFGRFDQIAQENQCLRIKILGDCYYCVSGLPISRPQHATNCVNMGLQMIDAIRHVREATGINV 407

Human  1994 DLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSE---GTPGFRAPEVARGNVIYNQQAD 2055
            |:                              |:||.|..   |..|.|           ..|.|
  Fly   408 DM------------------------------RIGIHTGNVLCGVLGLR-----------KWQFD 431

Human  2056 VYSFGLLLYDILTTGGRIVEG--------LKFPNEFDELEIQGK-------LPD-PVKEYGCAP- 2103
            |:|..:.|.:.:.:||  |.|        |.|..:..|:| ||:       |.| .|:.|...| 
  Fly   432 VWSDDVTLANHMESGG--VAGRVHITKQTLDFLGDKFEVE-QGEGGNRDAYLADHKVESYLIVPP 493

Human  2104 ---WPMVEKLIKQCLKENPQERPTSAQVFDILNSAEL--------VCLTRRILLPKNVIVECMVA 2157
               :......:.:|:::| ...||:.:..:|..:.:.        |.|...:..|..::.|.|..
  Fly   494 KPAYTYSVPRVVECIEQN-DPSPTTEETKEIKETDQSHEATDVADVLLPVTVAPPPAIVDEKMSP 557

Human  2158 THHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSG 2222
            |..||:.|.:     |......:.:.:.......:|..::..:...|:|                
  Fly   558 TSINSQEAPL-----HAPLASAASMSIKELSEEEDEADEATAVTEPLMH---------------- 601

Human  2223 TLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIF-EDKTVKLKGA- 2285
                 ..:|||  :..|...:.......:|.:.:|..|:..|...||..|::. .:..:...|| 
  Fly   602 -----RDQDGK--NDKEPKANGGHRGSGDSAASESVAKSAALSLPADDLLSMSGSESGISNSGAQ 659

Human  2286 ---------APLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSF------SNDFTIQKL 2335
                     .|......|..::..:.::|:...:.|.:...|    :.||      |..|     
  Fly   660 AQSSNPASVTPTAAAPAGGAASNSLTVAEAPERSRRKLSVQG----LMSFADRRRSSGAF----- 715

Human  2336 IETRTSQLFSYAAF-SDSNIITVVVDTALYIAKQNSP------VVEVW----------DKKTEKL 2383
            ||.|...:.|..:| |.:..:|           :|.|      .||.|          :.|..|.
  Fly   716 IEGRKLSIHSGESFRSHAGHVT-----------RNRPSSKMTKYVECWGADRPFANIAESKLVKN 769

Human  2384 CGLIDCVHFLREVMVKENKESKHKMSYSG---RVKTLCL-QKNT---ALWIGTGGGH-------- 2433
            .||.........::..|.|  ....::.|   .:|...: .:||   |::......|        
  Fly   770 IGLASIAMIESNLLPPERK--CFNFNFFGPPTELKPFTMWYRNTPREAMYRAQPDTHFRFDLICA 832

Human  2434 -ILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSL 2466
             :|.|.|:..:||.:..|.         |.||||
  Fly   833 FVLFLSLAVVQLIVIELNL---------ALLGSL 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150
leucine-rich repeat 1131..1174 CDD:275380
LRR 8 1174..1196
leucine-rich repeat 1175..1197 CDD:275380
LRR 9 1197..1218
leucine-rich repeat 1198..1221 CDD:275380
LRR 10 1221..1241
leucine-rich repeat 1222..1246 CDD:275380
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970 60/297 (20%)
WD 1 2139..2183 9/43 (21%)
WD 2 2188..2228 3/39 (8%)
WD 3 2233..2276 9/43 (21%)
WD 4 2281..2327 9/61 (15%)
WD 5 2333..2377 12/60 (20%)
WD 6 2402..2438 8/51 (16%)
WD 7 2443..2497 8/24 (33%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831 11/63 (17%)
CYCc 259..467 CDD:214485 55/287 (19%)
Guanylate_cyc 311..469 CDD:278633 42/212 (20%)
BASP1 510..667 CDD:283191 30/185 (16%)
CYCc 1079..1283 CDD:214485
Guanylate_cyc 1101..1305 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.