DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRK2 and CG33958

DIOPT Version :9

Sequence 1:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:505 Identity:94/505 - (18%)
Similarity:165/505 - (32%) Gaps:172/505 - (34%)


- Green bases have known domain annotations that are detailed below.


Human  2090 GKLPDPVKEYGC------APWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPK 2148
            |:.|||..   |      .|.|.|:..|..|....|.|..|:..  |:..|.|...|        
  Fly    10 GENPDPSP---CPAGGSRMPTPSVKIDISTCQSNRPMESRTAPD--DVNPSGEGGLL-------- 61

Human  2149 NVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADS---------------- 2197
                  :|.||||                 |....::....:||::::.                
  Fly    62 ------LVPTHHN-----------------LQLDKISVRSISSEDISNGGSGRCCNAAARNPAIK 103

Human  2198 ---RILCLALVHLP------------------VEKESWIVSGTQSGTLLVINTEDGK--KRHTLE 2239
               |:..:.::.||                  :|..|.:   ....|.:.|.|:.||  .|..||
  Fly   104 TGRRLQLMQMIILPFIPILALIVQTSVTLQEILEYRSAV---ADIETQVTIATDLGKVVTRLQLE 165

Human  2240 KMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLS 2304
            :   |....|.  |:..|||:..|.:..|:...|:....|             ...:|.|   .:
  Fly   166 R---SEVAFYI--FTNGSKQRANLTLRFANTDHALNNMTT-------------WSEISVP---TA 209

Human  2305 ESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQN 2369
            ...:..:|.:|           .|.:..|..:.          .|.|          .:.:..:.
  Fly   210 PDEDEDDREMM-----------LNRYEFQSRLN----------EFRD----------RVRLEPEE 243

Human  2370 SPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKES---KHKMSYSGRVKTLCLQKNTALWIGT-- 2429
            |.:.||.:..|....||:   |.|.| .:||...|   ::.:.:...:|::..| |.|...|.  
  Fly   244 SSITEVMNWYTSINRGLL---HHLSE-QIKETDNSGVWRYLVGFKNLLKSIECQ-NIATSFGIRY 303

Human  2430 -GGGHI--------LLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQK 2485
             |.|.:        :..:...|.:|....|:...::.|.|       |:.....::|....||..
  Fly   304 YGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYT-------NITSTKKFHRAKQMGTTL 361

Human  2486 QK------EIQSCLTVWDI--NLPHEVQNLEKHIEVRKELAEKMRRTSVE 2527
            .|      ..:|.:..:::  |...:::.|:|  .:|:.:.|.:.:|.||
  Fly   362 LKNNPNVSNERSAIEYYELMNNYTDDLRILQK--ALRRLIKEYVDKTLVE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150
leucine-rich repeat 1131..1174 CDD:275380
LRR 8 1174..1196
leucine-rich repeat 1175..1197 CDD:275380
LRR 9 1197..1218
leucine-rich repeat 1198..1221 CDD:275380
LRR 10 1221..1241
leucine-rich repeat 1222..1246 CDD:275380
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970 14/50 (28%)
WD 1 2139..2183 7/43 (16%)
WD 2 2188..2228 8/76 (11%)
WD 3 2233..2276 13/44 (30%)
WD 4 2281..2327 4/45 (9%)
WD 5 2333..2377 6/43 (14%)
WD 6 2402..2438 8/49 (16%)
WD 7 2443..2497 10/59 (17%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564 54/302 (18%)
HNOBA <439..479 CDD:285003
CYCc 459..647 CDD:214485
Guanylate_cyc 485..669 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.