DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRK2 and ACXC

DIOPT Version :9

Sequence 1:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens
Sequence 2:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster


Alignment Length:814 Identity:149/814 - (18%)
Similarity:264/814 - (32%) Gaps:298/814 - (36%)


- Green bases have known domain annotations that are detailed below.


Human  1858 DLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLR-LLRQEL 1921
            |:|..|:..|:..|...:.|.     ::.|    ::.||::....   :...:.|.|| .|.||.
  Fly   211 DVISTDILHNLGFNMMGIFFR-----IMND----TMVRASFLDRH---QFIMEETWLRHALLQES 263

Human  1922 VVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLH 1986
            ::|..:..|.:...:...|:.::    ..|:.|.||....     .||.:..:|:.:...:..|:
  Fly   264 ILLDSILPPQIAKPVQEKIKSKI----TQSENSPDRFQMG-----PRTTESFMAIQIHPDVSILY 319

Human  1987 SAMIIYRDLKP----HNV--LLFTLYPNAAIIA------KIADYGIAQYCCRMGIKTSEGTPGFR 2039
            :.::.|..|..    .|:  :|..||....|.|      :|...|...||. .|:.|.:  |...
  Fly   320 ADVVNYTHLTTTLTVGNLVKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCV-AGLTTPD--PDHA 381

Human  2040 APEVARG-NVIYNQQADVYSFGLLLYDI-LTTG---GRIVEGLKFPNEFDELEIQGKLPDPVKEY 2099
            ...|:.| ::|.|.|......||   || :..|   |.::.|:     ..|.::|          
  Fly   382 KCCVSLGISMISNIQEVRAERGL---DIDMRIGVHSGSLLAGI-----IGEAKLQ---------- 428

Human  2100 GCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRN 2164
                                         |||..:                  :..:|.|..|..
  Fly   429 -----------------------------FDIWGT------------------DVEIANHLESTG 446

Human  2165 ASIWLGCGHTDRGQLSFLDLNTEGYT----SEEVADSRILCLALVHL---PVEKESWIVS--GTQ 2220
            ..   |..|.....||.  ||...||    :::.....:|.....:|   .|.:||:|.|  |.:
  Fly   447 EP---GYVHVSGRTLSM--LNPADYTILSGTQKAQSDPVLQYIHTYLLTGQVARESFITSIGGVR 506

Human  2221 SGTLLVINTED--GKKRHTLEKMTD-----------------SVTC----------------LYC 2250
            |.::|.:.:.|  ...|.:...|||                 |..|                ::|
  Fly   507 SSSVLEVKSIDRIRSSRPSQSSMTDEFREEFRNMPVGGINLNSPCCRRTRLDTHKKTQREIGIFC 571

Human  2251 NSFSKQSKQKNFL-----------LVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVS------- 2297
            .:|...|.:.|:|           |:....|...|:            ::|:. .|.|       
  Fly   572 AAFKDSSLEWNYLHQPDFIFKSSMLLAWGIGCCLIY------------IQIVT-NNFSCTACIVV 623

Human  2298 --------TPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFT---------IQKLIETRTSQ--- 2342
                    |.|:||     :..:||.|...|...|.....::         ||..:..|.:.   
  Fly   624 DLVTFFFLTSLLCL-----AWYKNVCWWKSGRYEFRIYGKYSCMAFHIFEKIQHSVSLRITVYLG 683

Human  2343 -LFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKH 2406
             ||||.|     :|:::                           :::|...:.|:...|:|...:
  Fly   684 ILFSYYA-----VISLI---------------------------MLNCDRDMYELSYIESKIYHY 716

Human  2407 KMSYSGRVKTLCLQKNTALWIGTGGGHILL-LDLSTRRL---IRVIYNFCNSVRVM--------- 2458
            :|.     :..|...    |:.|....::| :..:..|:   ::::.:.|.::..:         
  Fly   717 EMD-----RDTCFHP----WVFTNMISLILGISYTFARIPFGLKIVISCCETLAYLLIVFFQFAF 772

Human  2459 -----------MTAQLGSLKNVMLVL----------GYNRK-----NTEGTQKQKEI----QSCL 2493
                       |.|:|.....|.::|          .:|.|     |.:...|||..    ||.:
  Fly   773 IFQHSATTTPFMKAELAHCLRVCMMLLTMYAKERQSEFNTKMNYKLNVDLQNKQKAADLTNQSII 837

Human  2494 TVWDINLPHEVQNLEKHIEVRKEL-AEKMRRTSV 2526
            .:.:..||..|.:|..:...:.|| .|..|..||
  Fly   838 ILLNNILPSHVVDLYLNSLAKHELYYENYRMVSV 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150
leucine-rich repeat 1131..1174 CDD:275380
LRR 8 1174..1196
leucine-rich repeat 1175..1197 CDD:275380
LRR 9 1197..1218
leucine-rich repeat 1198..1221 CDD:275380
LRR 10 1221..1241
leucine-rich repeat 1222..1246 CDD:275380
LRR 11 1246..1267
leucine-rich repeat 1247..1269 CDD:275380
LRR 12 1269..1291
RocCOR 1334..1507 CDD:206741
COR 1527..1740 CDD:318343
STKc_LRRK2 1884..2135 CDD:270970 52/268 (19%)
WD 1 2139..2183 7/43 (16%)
WD 2 2188..2228 12/48 (25%)
WD 3 2233..2276 14/86 (16%)
WD 4 2281..2327 12/60 (20%)
WD 5 2333..2377 8/47 (17%)
WD 6 2402..2438 6/36 (17%)
WD 7 2443..2497 15/95 (16%)
ACXCNP_609593.1 AC_N <33..285 CDD:292831 18/85 (21%)
CYCc 293..468 CDD:214485 48/252 (19%)
Nucleotidyl_cyc_III 307..466 CDD:299850 43/231 (19%)
CYCc 833..1060 CDD:214485 12/39 (31%)
Nucleotidyl_cyc_III 861..1085 CDD:299850 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.