DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRRK2 and rut

DIOPT Version :9

Sequence 1:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:972 Identity:176/972 - (18%)
Similarity:312/972 - (32%) Gaps:307/972 - (31%)


- Green bases have known domain annotations that are detailed below.


Human  1137 SKNHISSLSENFLEAC--PKVESFSARMNFLAA-----MPFLPPSMTILKLS-----------QN 1183
            |.|..:|...:....|  |:..|.||...||:.     :|.:..|:.:|.:.           ||
  Fly   798 SGNGTTSFQNDSHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQN 862

Human  1184 KFSCIPEAI-LNLP-HLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISIL-------DLSE 1239
            .|.|....: .::| ||.||                    .|..:|   .|:||       ..:.
  Fly   863 IFECYDNRVNASIPLHLISL--------------------ARIAIF---MIAILVHGRLVEGTAR 904

Human  1240 KAYLWSRVEKLHLSHNK-----LKEIPPEIGCLENLTS-------LDVSYNLELRSFPNEMGKLS 1292
            ..:||    :|..|..|     |:|....|  |.||..       ||..:...:..:.....|:.
  Fly   905 LDFLW----QLQASQEKKEMDVLQESNKRI--LHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVG 963

Human  1293 KIW-DLP-LDELHLNFDFKHIGCKA----KDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLL 1351
            .|: .:| .:|.:...|....|.:.    .:||....:.||:.......|:..||:|        
  Fly   964 VIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGST-------- 1020

Human  1352 QQLMKTKKSDLGMQSATVGIDVKDWPIQIRDK---RKRDLVLNVWDFAGREEFYSTHPHFMTQRA 1413
                         ..|.||: :.::.||..|.   |:....|..:..|.|......:.|......
  Fly  1021 -------------YMAVVGL-IPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHSYNNFM 1071

Human  1414 LYLAVYDLSKGQAEVDAMKP----W--LFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKE 1472
            |.:.:.........:.|.||    |  ..|:.:|..|:.|                ...|::|:|
  Fly  1072 LRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGV----------------PGYSQVTQE 1120

Human  1473 LLNKRGFPAIRDYHF-------VNATEESDALAKLRKTIINESLNFKIRDQLVVGQLI--PDCYV 1528
            :::     ::...||       :....:.|.:........|:|||.::|:.:.:.|.:  ||.|:
  Fly  1121 VVD-----SLVGSHFEFRCRGTIKVKGKGDMVTYFLCDSGNKSLNGEVRNAMSLPQSLHAPDYYM 1180

Human  1529 ELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLD-----ENELPHAVHFLNESGVLL---HF 1585
            ::.            :||            ||::..|     ||...:|.:.:.|..:||   |.
  Fly  1181 KVS------------QFP------------ENRVNTDTYSKKENGHLYAGNGVEEQQLLLQHQHK 1221

Human  1586 QDPALQL--------SDLYFVEPKWL-CKIMAQILTVKVEGCP-----------KHPKGIISRRD 1630
            |...|.|        ..|:..:.:.| .|:..|.:.:...|.|           :|.:....::.
  Fly  1222 QHDPLPLPAPPPPVHHHLHQQQQQRLNSKLQKQPIFMANGGLPNIRENGNGHNGEHQQQQQQQQQ 1286

Human  1631 VEKFLSKKRKF-------------------PKNYMSQYFKLLEKFQ----------IALPIGEEY 1666
            .::...::::.                   |:::..|       ||          :::|:..:.
  Fly  1287 HQQQQQQQQQHGGFMVATTTPPAAVAVPLQPQHHQLQ-------FQHPHQHPLPSAVSVPVQHQI 1344

Human  1667 LLVPSSLSDHRPV-----IELPHCENSEIIIRLYEMPYFP------------MGFWSRLINRLLE 1714
            ||.......|:||     .|....||.....|..:|...|            ||..:.::..   
  Fly  1345 LLHHQLQLQHQPVPSVMLREFNIIENPTSGGRHQQMEQLPPHHGSLDLSGMGMGVGAGVLGS--- 1406

Human  1715 ISPYMLSGRERALR------------PNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITV 1767
             ..:|:..|:|...            |:.::  ..:.||.|             .||.||..:..
  Fly  1407 -DCFMMPRRDRERTYVPPLNQHGHHPPHHLH--SNLNLNQS-------------QHPPSFTSLGY 1455

Human  1768 PSCRKGCILL-GQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQ----KILL 1827
            ..||:...|| ...|..:..:|........|........|:|.:..........:||    :...
  Fly  1456 GQCRESEPLLHASSVAPVAKIMPMQHAPKYEPPRYTSPHTMLSQQHQQQQQQQHQHQQPQSQSAQ 1520

Human  1828 DDLMKKAEEGDLL-----VNPDQPRL---------TIPISQIAPDLILADLPRNIMLNNDELEFE 1878
            |.....|::...|     :...||:|         ..|:.::..||   :..|::...:|.....
  Fly  1521 DQQTHPAQDPHPLQRQYAMYSQQPQLPPKPVLRTYMKPLPKLPTDL---EESRDMSSTDDLSSRP 1582

Human  1879 QAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGI 1940
            .:|.....|.|:........||:|.:.::.|..              ||||.:...|.|.|:
  Fly  1583 HSPSMSSSDESYSKTTEGEGEGDEDSPRMVNGG--------------HLHHRNGYHLPAGGL 1630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969
LRR 1 983..1004
leucine-rich repeat 985..1012 CDD:275380
LRR 1012..>1286 CDD:227223 40/187 (21%)
LRR 2 1012..1033
leucine-rich repeat 1013..1036 CDD:275380
LRR 3 1036..1057
leucine-rich repeat 1037..1084 CDD:275380
LRR 4 1059..1080
LRR 5 1084..1105
leucine-rich repeat 1085..1108 CDD:275380
LRR 6 1108..1129
leucine-rich repeat 1109..1130 CDD:275380
LRR 7 1130..1150 3/12 (25%)
leucine-rich repeat 1131..1174 CDD:275380 11/43 (26%)
LRR 8 1174..1196 6/33 (18%)
leucine-rich repeat 1175..1197 CDD:275380 6/34 (18%)
LRR 9 1197..1218 4/20 (20%)
leucine-rich repeat 1198..1221 CDD:275380 3/22 (14%)
LRR 10 1221..1241 5/26 (19%)
leucine-rich repeat 1222..1246 CDD:275380 7/30 (23%)
LRR 11 1246..1267 6/25 (24%)
leucine-rich repeat 1247..1269 CDD:275380 7/26 (27%)
LRR 12 1269..1291 4/28 (14%)
RocCOR 1334..1507 CDD:206741 30/188 (16%)
COR 1527..1740 CDD:318343 45/298 (15%)
STKc_LRRK2 1884..2135 CDD:270970 13/57 (23%)
WD 1 2139..2183
WD 2 2188..2228
WD 3 2233..2276
WD 4 2281..2327
WD 5 2333..2377
WD 6 2402..2438
WD 7 2443..2497
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 25/117 (21%)
CYCc 924..1134 CDD:214485 46/254 (18%)
Guanylate_cyc 954..1151 CDD:278633 40/239 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.