DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcl6 and CG14655

DIOPT Version :9

Sequence 1:NP_001334955.1 Gene:Bcl6 / 12053 MGIID:107187 Length:707 Species:Mus musculus
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:501 Identity:123/501 - (24%)
Similarity:183/501 - (36%) Gaps:137/501 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse   254 LCHSNIYSPKEAVPE----EARSDIHYSVPEGPKPAVPSARNAPYFPCDKASKEEERPSSEDEIA 314
            :|.:::..|..|||.    :|..........||..       .|:..|      :|.....|::.
  Fly     1 MCSTSVLCPLCAVPSFGSIDALQQRLIKAANGPLA-------CPFANC------KELFLGLDKLT 52

Mouse   315 LHF-------------EPPNA-PLNRKGLVSPQSP----QKSDCQPNSPTESCSSKNACILQASG 361
            :|.             .|.|. |.:.:|.::...|    :::..:|..||               
  Fly    53 IHLFSHTSLMAQEGNESPANGQPASSRGFLAAAPPKRRAKRTRSKPVVPT--------------- 102

Mouse   362 SPPAKSPTDPKACNWKKYKF-------IVLNSLNQNAKPEGSEQAELGRLSPRAYPAPPACQPPM 419
             ||....|.|..|:..::.|       :.:..:::||:.|..::            .|...:|..
  Fly   103 -PPPVRTTPPAHCDICEFSFRNTELRDMHVRLVHENAEGEPKQK------------EPQQKEPDQ 154

Mouse   420 EPANLDLQSPT-KLSASGEDSTIPQASRLNNLVNRSLAGSPRSSSESHSPLYMHPPKCTSCGSQS 483
            ||....|.|.| ::..|         .|::..|.. :.|.|.|:...:......|...||..:.:
  Fly   155 EPYKCHLCSKTFRMKGS---------LRIHLKVVH-MMGVPCSNPNPNPNPSPTPASTTSAVTAT 209

Mouse   484 P--------QHTE----------MCLHTAGPTFPEEMGETQSEYSDSSCENGTFFCNECDCRFSE 530
            |        :|||          .|  ||...:......:..:.|.||.|:|             
  Fly   210 PKLSICDRIRHTEPGALGNGNNSTC--TASQPYALSGALSMLQQSPSSPESG------------- 259

Mouse   531 EASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTR 595
                      |.:.|.::||.|..||..|..|..||.:||||.||.|.||...|....:...|..
  Fly   260 ----------TATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLL 314

Mouse   596 IHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYH 660
            .||..||:.|..||..|.:::.|..|..||:||||:.||:||..||...:...|.|||||..||.
  Fly   315 YHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPYK 379

Mouse   661 CEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSAADLPPELPKA 706
            ||.|...||:|...|.|             :.....|..|.:|.||
  Fly   380 CELCQKTFRYKVSQRTH-------------RCPTEEAQTPEQLIKA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcl6NP_001334955.1 BTB_POZ_ZBTB27_BCL6 8..125 CDD:349640
PHA03247 <179..429 CDD:223021 35/203 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..350 15/92 (16%)
Required for interaction with NuRD complex and for transcriptional repressor activity 377..380 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..469 13/64 (20%)
C2H2 Zn finger 521..542 CDD:275368 0/20 (0%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
zf-H2C2_2 561..586 CDD:372612 13/24 (54%)
C2H2 Zn finger 577..597 CDD:275368 5/19 (26%)
zf-H2C2_2 589..614 CDD:372612 9/24 (38%)
C2H2 Zn finger 605..625 CDD:275368 6/19 (32%)
zf-H2C2_2 617..642 CDD:372612 13/24 (54%)
C2H2 Zn finger 633..653 CDD:275368 8/19 (42%)
zf-H2C2_2 646..670 CDD:372612 12/23 (52%)
C2H2 Zn finger 661..679 CDD:275368 8/17 (47%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
zf-H2C2_2 339..361 CDD:290200 12/21 (57%)
C2H2 Zn finger 352..372 CDD:275368 8/19 (42%)
zf-H2C2_2 364..389 CDD:290200 12/24 (50%)
C2H2 Zn finger 380..396 CDD:275368 7/15 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4277
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.