DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcl2a1d and Debcl

DIOPT Version :9

Sequence 1:NP_031562.1 Gene:Bcl2a1d / 12047 MGIID:1278325 Length:172 Species:Mus musculus
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:171 Identity:42/171 - (24%)
Similarity:72/171 - (42%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 PAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGR 88
            ||..|...:..|:..||..::.:::.:.....|:|     .|.|.::.|.|.:..|... |.||:
  Fly   144 PALNSMGEELERMHPRVYTNISRQLSRAPFGELED-----SDMAPMLLNLVAKDLFRSS-ITWGK 202

Mouse    89 IVTIFAF-GGVLLKKLPQEQIALDVGAYKQVSSFV---AEFIMNNTGEWIRRNGGWEDGFIKKFE 149
            |::|||. ||..:..:.|       |.:..:...:   ||.|.::...|:..||||. |..:...
  Fly   203 IISIFAVCGGFAIDCVRQ-------GHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWL-GLSRHIR 259

Mouse   150 PKSGWLTFL---------------------QMTGQIWEMLF 169
            |:.|..|||                     ::.||::.:||
  Fly   260 PRVGEFTFLGWLTLFVTISAGAYMVSNVCRRIGGQLYSLLF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcl2a1dNP_031562.1 BCL 37..140 CDD:214626 26/106 (25%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.