DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcl2a1c and Debcl

DIOPT Version :9

Sequence 1:NP_031561.2 Gene:Bcl2a1c / 12046 MGIID:1278327 Length:128 Species:Mus musculus
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:87 Identity:23/87 - (26%)
Similarity:40/87 - (45%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 PAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGIINWGR 88
            ||..|...:..|:..||..::.:::.:.....|:|     .|...::.|.|.:..|.:. |.||:
  Fly   144 PALNSMGEELERMHPRVYTNISRQLSRAPFGELED-----SDMAPMLLNLVAKDLFRSS-ITWGK 202

Mouse    89 IVTIFAF-GGVLLKKTSTRADC 109
            |::|||. ||..:       ||
  Fly   203 IISIFAVCGGFAI-------DC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcl2a1cNP_031561.2 BCL 37..>108 CDD:214626 17/71 (24%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.