DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bcl2 and Debcl

DIOPT Version :9

Sequence 1:NP_033871.2 Gene:Bcl2 / 12043 MGIID:88138 Length:236 Species:Mus musculus
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:279 Identity:63/279 - (22%)
Similarity:91/279 - (32%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 YKLSQRG------YEWDA-----GDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPL-- 72
            |..::||      .:|.|     |.....| |:.|.|..........||     ..||.||.|  
  Fly    24 YTANRRGTIATASSDWKALRGGVGGGAGGP-GSVPNPSNGRSLHAGGPM-----TRAASTSSLAS 82

Mouse    73 ---------------------------RPLVATAG---------------PALSPVPPVVHLTLR 95
                                       |..:..||               |..|.|...|...|.
  Fly    83 STRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALN 147

Mouse    96 RAGDDFSRRYRRDFAEMSSQLHLTPF-------TARGRFATVVEELFRDGVNWGRIVAFFEFGGV 153
            ..|::..|.:.|.:..:|.||...||       .|......|.::|||..:.||:|::.|...|.
  Fly   148 SMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGG 212

Mouse   154 MCVESVNR----EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSL 214
            ..::.|.:    .:..|:|.:|    |.:...|..|:.|||||........|.:.......||:|
  Fly   213 FAIDCVRQGHFDYLQCLIDGLA----EIIEDDLVYWLIDNGGWLGLSRHIRPRVGEFTFLGWLTL 273

Mouse   215 KTLLSLALVGACITLGAYL 233
            ...:|         .|||:
  Fly   274 FVTIS---------AGAYM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bcl2NP_033871.2 BH4 7..33 CDD:128561 5/22 (23%)
BH4 10..30 3/14 (21%)
bcl-2 11..236 CDD:273308 63/279 (23%)
Bcl-2_like 81..198 CDD:132900 35/127 (28%)
BH3 90..104 3/13 (23%)
BH1 133..152 7/18 (39%)
BH2 184..199 6/14 (43%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.