DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bche and alpha-Est2

DIOPT Version :9

Sequence 1:XP_011238302.1 Gene:Bche / 12038 MGIID:894278 Length:615 Species:Mus musculus
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:628 Identity:171/628 - (27%)
Similarity:266/628 - (42%) Gaps:153/628 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 VQEINMQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGLSMPVLGGTV------ 66
            ||:..:.|.||                          .|:.||.|:||||...    ||      
  Fly    22 VQQYRLSTGHT--------------------------VILDTKYGQVRGLQRK----TVYDKEPY 56

Mouse    67 TAFLGIPYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQAFPGFQGSEMWNPNTNL-- 129
            .||.|||||:||:|.|||:.|||...|..:.|.|...:...|.                |..|  
  Fly    57 FAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQR----------------NMLLGI 105

Mouse   130 ---SEDCLYLNVWIPVPK-PKNATVMVWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSMNYRVG 190
               |||||:|||::...| .|...|:|||||||||.|.:|..:|...:..: :.|:.|::|||:.
  Fly   106 VEGSEDCLHLNVYVKALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFMK-KPVVFVAINYRLA 169

Mouse   191 ALGFLAFPGNP--DAPGNMGLFDQQLALQWVQRNIAAFGGNPKSITIFGESAGAASVSLHLLCPQ 253
            |||||:.. :|  |.|||.||.||.:||:|:.:|||.|.|:|.:||:.|||||:|||.:.:...|
  Fly   170 ALGFLSLK-DPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQ 233

Mouse   254 SYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKFTGC-SKENEMEMIKCLRSKDPQEILRNE 317
            :..||.:||::||.:.:.| |:.|:  .|....||:..|. ..|.:.:::..|.....::|...:
  Fly   234 TRGLFHKAIMQSGCALSEW-VESPD--NNWAFRLAQNLGYKGDEKDADVLSFLSKVCARQIAAID 295

Mouse   318 RFVLPSD---SILSINFGPTVDGDFLTD---MP---HTLLQLGKVKKAQILVGVNKDEG--TAFL 371
            :.|:..|   |.|...|||.:: .:.||   :|   ..||.........::||.|..||  :..|
  Fly   296 QDVINLDEVRSFLLFAFGPVIE-PYETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFEGLFSYQL 359

Mouse   372 VYGAPGFSKDNDSLITRK------------------------EFQEGLNMYFPGVSRLGKEAVLF 412
            |...|...|:..:::.|:                        |.||.:.|:         ||:..
  Fly   360 VRKDPWALKNFHNILPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMF---------EALNI 415

Mouse   413 YYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFFYFFEHRSSKLPWPEW--- 474
            :       ...:::.|.       :..|.....:..|     ...:.|.|:..|     |.:   
  Fly   416 F-------SHRQIWHDT-------HRFILARQSYAPK-----TPTYLYRFDFDS-----PHFNQF 456

Mouse   475 ---------MGVMHGYEIEFVFGLPLGRRVNYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNSTM 530
                     .||.|..|:.::|...:..:::.:..|......::..|.:||..|:||..:..|..
  Fly   457 RRLVCGDRIRGVAHADELSYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPNCPELGSAK 521

Mouse   531 WPVFTSTE---QKYLTLNTEKSKIYSKLRAPQC-QFWRLFFPK 569
            |......|   :|...::.:..  ...|....| ..|..|:|:
  Fly   522 WEAVQLKENAVEKCFNISHDLE--MRDLPESDCLAVWDTFYPR 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BcheXP_011238302.1 COesterase 46..563 CDD:365897 163/582 (28%)
AChE_tetra 578..612 CDD:370053
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 159/575 (28%)
Aes <117..>221 CDD:223730 49/105 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.