DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bax and Buffy

DIOPT Version :9

Sequence 1:XP_011249082.1 Gene:Bax / 12028 MGIID:99702 Length:221 Species:Mus musculus
Sequence 2:NP_523702.1 Gene:Buffy / 36251 FlyBaseID:FBgn0040491 Length:299 Species:Drosophila melanogaster


Alignment Length:198 Identity:40/198 - (20%)
Similarity:71/198 - (35%) Gaps:52/198 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 SEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQ------PPQDASTKKLSECLRRIGDELDSNM 74
            ::.|:..|..|...:|:.|..|......:|.|::      .......:.:...::.:||      
  Fly    86 AQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGSTSMGIVRDVFPAVQVLGD------ 144

Mouse    75 ELQRMIADVDTDSPREV------------------------FFRVAADMFADGNFNWGRVVALFY 115
            ||:||...:.....|::                        .|||        ...|.:|::||.
  Fly   145 ELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRV--------EITWSKVISLFA 201

Mouse   116 FASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGW------VRPLSEDLNKLH--RL 172
            .|..|.:..:....||.:..:|....:.:.:.|:.||.:.|||      |.|.:..||.|.  .|
  Fly   202 IAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGINTHVLPTTNSLNPLEWTTL 266

Mouse   173 ALG 175
            .:|
  Fly   267 VIG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BaxXP_011249082.1 bcl-2 5..>158 CDD:273308 31/171 (18%)
BuffyNP_523702.1 Bcl-2_like 99..250 CDD:132900 30/164 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.