DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD3 and MDE1

DIOPT Version :10

Sequence 1:NP_058432.1 Gene:ADD3 / 120 HGNCID:245 Length:706 Species:Homo sapiens
Sequence 2:NP_012558.3 Gene:MDE1 / 853481 SGDID:S000003785 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:27/132 - (20%)
Similarity:51/132 - (38%) Gaps:39/132 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   213 FSPHA------AIYSTRPDVKCVIHIHTLATAAVSSMKCG------------------ILPISQE 253
            :.|.|      |.|. :.:...:||.|: ..|.:.|:..|                  :.|::::
Yeast    84 YKPSACTPLFLACYQ-KKNAGAIIHTHS-QNAVICSLLFGDEFRIANIEQIKAIPSGKVDPVTKK 146

Human   254 SLLLGDVAYYD------YQGSLEEQEERIQLQKVLG--PSCKVLVLRNHGVVALGETLEEAFHYI 310
            .:.|   :::|      .:....|.|....|.|...  |....:::|.||:...|.|:::|  .|
Yeast   147 PMAL---SFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDTCAVIVRRHGIFVWGPTIDKA--KI 206

Human   311 FN 312
            ||
Yeast   207 FN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD3NP_058432.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Aldolase_II 137..385 CDD:469663 27/132 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 471..497
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 535..555
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..610
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 666..706
Interaction with calmodulin. /evidence=ECO:0000255 684..701
MDE1NP_012558.3 Aldolase_II 14..238 CDD:238232 27/132 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.