DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnrnpd and Rb97D

DIOPT Version :9

Sequence 1:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:317 Identity:100/317 - (31%)
Similarity:148/317 - (46%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 PRHTEAA----AAQREE---------WKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITG 135
            |...|:|    .|.|||         .|:|||||:..||:::||.::.::|:|||..:..|..|.
  Fly     6 PLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATK 70

Mouse   136 RSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------KAMKTKEPVKKIFVGGLSPDTP 194
            |||||||:.:.:|..||:..:.:.|.::||.::.|||      ::.:|...|||:|||||..:..
  Fly    71 RSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHD 135

Mouse   195 EEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMS 259
            ||.:||||..||.|.|::|..|..|.|||||.|:.|.:.:.|.|.:.||.|.:.....::|.::.
  Fly   136 EECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIY 200

Mouse   260 KEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYN--------------SQ 310
            ....:::||   .||.|...:     ||.|..|     ..||.|....|              .|
  Fly   201 NLDKKEKQQ---PGGLANAIK-----PSLNQQQ-----QQQGGGQQPPNGNMQAPSFRPPVPPQQ 252

Mouse   311 GYGGY-------------GGYDYTG-----YNNYY---------GYGDY-SNQQSGY 339
            ..|.|             ..::|.|     ...||         |:|.| ..||:|:
  Fly   253 AMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 3/10 (30%)
CBFNT <60..78 CDD:311868
RRM1_hnRNPD_like 99..172 CDD:241019 29/72 (40%)
RRM2_hnRNPD 183..257 CDD:241027 32/73 (44%)
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 32/76 (42%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.