DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hnrnpd and CG4612

DIOPT Version :9

Sequence 1:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:127/284 - (44%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 GDGAAAA---ATAAVGGSAGEQEGAMVAAAAQGPAAAAGSGSGGGGSAAGGTEGGSAEAEGAKID 69
            |.|.||:   |.|||.|..|.........:....:|..|.|.|||..|:|.| |||.        
  Fly    50 GGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGST-GGSG-------- 105

Mouse    70 ASKNEEDEGHSNSSPRHTEAAAAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPIT 134
                      .||||          :..|::|..|......|.:.|.||.||.:::|.:..|. .
  Fly   106 ----------GNSSP----------DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-D 149

Mouse   135 GRSRGFGFVLFKESE----SVDKV-----MDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLS 190
            |.|||:|||.|...|    :::||     .:||.|.:  |.| |:|.:..:.....|.::|..||
  Fly   150 GNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV--KFI-PRRDREQEKATHFKNLYVKNLS 211

Mouse   191 PDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPV---------KKIMEKKYHN 246
            .:..|:.:||.|..:|.:.|.:|.:|.:...|| |.|:.::..:..         |::.:.|:..
  Fly   212 EEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLY 275

Mouse   247 V--GLSKCEIKVAMSKEQYQQQQQ 268
            |  .|||.|.:..::::..::::|
  Fly   276 VARALSKAERQQEINRKLEERKRQ 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 26/85 (31%)
CBFNT <60..78 CDD:311868 1/17 (6%)
RRM1_hnRNPD_like 99..172 CDD:241019 27/81 (33%)
RRM2_hnRNPD 183..257 CDD:241027 22/84 (26%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/70 (33%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.