DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLK3 and Hipk

DIOPT Version :9

Sequence 1:NP_001123500.2 Gene:CLK3 / 1198 HGNCID:2071 Length:490 Species:Homo sapiens
Sequence 2:NP_001369036.1 Gene:Hipk / 38070 FlyBaseID:FBgn0035142 Length:1409 Species:Drosophila melanogaster


Alignment Length:408 Identity:121/408 - (29%)
Similarity:201/408 - (49%) Gaps:64/408 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    99 GPYRTRKHAHHCHKRRTR-SCSSASSRSQQSSKRSSRSVEDDKE--GHLVCRIGDWLQERYEIVG 160
            ||..:.|.||      |: :.|...:.:|..|||||...:.|.:  .|.|...   |...||::.
  Fly   141 GPISSLKTAH------TKVATSGGHANTQPPSKRSSSGADGDYQLVQHEVLYS---LSAEYEVLE 196

Human   161 NLGEGTFGKVVECLDHARGKSQ-VALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSD 224
            .||.||||:||:|  ..||.|: ||:||::|...|....::|:::|.::.:::.: :|..|...:
  Fly   197 FLGRGTFGQVVKC--WKRGTSEIVAIKILKNHPSYARQGQIEVSILSRLSQENAD-EFNFVRAFE 258

Human   225 WFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENI 289
            .|....|.|:.||:|.:|.::|||:|.|.|.||.::|.:..|:..||..|.:..|.|.|||||||
  Fly   259 CFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILEQVLTALLKLKQLGLIHADLKPENI 323

Human   290 LFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT---TIVATRHYRPPEVILELGW 351
            :.|:...:..               .::|.|||||:  |...|   |.:.:|:||.||:||.|.:
  Fly   324 MLVDPVRQPY---------------RVKVIDFGSAS--HVSKTVCNTYLQSRYYRAPEIILGLPF 371

Human   352 AQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRK-QKYFYKG----G 411
            .:..|:||:||::.|.:.|:.|:......:.:..:.:..|....||::...| .|:||:.    .
  Fly   372 CEAIDMWSLGCVVAELFLGWPLYPGSSEFDQIRYISQTQGLPTEHMLNSASKTSKFFYRDVDSTY 436

Human   412 LVWDENSSDGRYVKENCKPLKS-----------------------YMLQDSLEHVQLFDLMRRML 453
            ..|...:::....:.|.|..::                       .:|.:..:..:..||::|||
  Fly   437 PFWRLKTTEEHEAETNTKSKEARKYIFNCLDDIGQVNVPTDLEGGQLLAEKTDRREFIDLLKRML 501

Human   454 EFDPAQRITLAEALLHPF 471
            ..|..:|:|.||||.|.|
  Fly   502 TIDQERRLTPAEALNHSF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLK3NP_001123500.2 PKc_CLK3 142..472 CDD:271116 107/362 (30%)
HipkNP_001369036.1 STKc_HIPK 192..520 CDD:271113 104/348 (30%)
PHA03378 <1080..1327 CDD:223065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.