DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLK2 and Dyrk2

DIOPT Version :9

Sequence 1:NP_001281267.1 Gene:CLK2 / 1196 HGNCID:2069 Length:499 Species:Homo sapiens
Sequence 2:NP_001260456.1 Gene:Dyrk2 / 34831 FlyBaseID:FBgn0016930 Length:757 Species:Drosophila melanogaster


Alignment Length:365 Identity:116/365 - (31%)
Similarity:199/365 - (54%) Gaps:42/365 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   128 FSRSSSQHSSRRAKSVE------DDAEGH--LIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHR 184
            |.:.:|::.::.|.:..      ||..|:  :|.|  |.:..||||:..:|:|:||:|::.:||:
  Fly   192 FGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEH--DHIAFRYEILEVIGKGSFGQVIRALDHK 254

Human   185 RGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLS 249
            . ...||:|||:|.:::...|.:|:|:|:::.|||.|..:..:.|.|:..:..|:||:|||:.|:
  Fly   255 T-NTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLN 318

Human   250 TFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRD 314
            .::.:|.|||..:.:..:|.....:.:.::.|:...:.|.||||||||.            |:|.
  Fly   319 LYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILL------------KQRG 371

Human   315 ERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFT 379
                 |::::|:||||:.:......|.:.:|.||:|||||.|.:....|:||:|||:.|.|.||.
  Fly   372 -----SSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFP 431

Human   380 LFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTS 444
            ||...:..|.||.:..:||..|..:|...|:::.|:..|       .|.|.: .|.|..:|...|
  Fly   432 LFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSR-------DAPRCI-TNTKGRKRSPGS 488

Human   445 EAEEH------HQLFDLIESMLEYEPAKRLTLGEALQHPF 478
            ::..|      ....|.::..||::||:|:|..||..|.|
  Fly   489 KSLAHILHCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEF 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLK2NP_001281267.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 3/14 (21%)
PKc_CLK2 150..479 CDD:271117 110/337 (33%)
Dyrk2NP_001260456.1 PKc_DYRK4 186..529 CDD:271127 116/365 (32%)
S_TKc 233..529 CDD:214567 106/322 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.