DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp5pb and ATPsynbeta

DIOPT Version :9

Sequence 1:NP_033855.2 Gene:Atp5pb / 11950 MGIID:1100495 Length:256 Species:Mus musculus
Sequence 2:NP_001259081.1 Gene:ATPsynbeta / 43829 FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster


Alignment Length:170 Identity:41/170 - (24%)
Similarity:62/170 - (36%) Gaps:53/170 - (31%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 LSRVVLSAAATAAPCLKNAAALG-------------------PGVLQATRAFHTGQPRLAPLPPL 47
            ||....||.:.||...|.|||..                   |.:|.|... ....|||  :..:
  Fly    21 LSTAPFSARSHAAKAAKAAAAANGKIVAVIGAVVDVQFDDNLPPILNALEV-DNRSPRL--VLEV 82

Mouse    48 PEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYVITPETFSTISVVGLIVYV 112
            .::.|:..:..|..:..:.|     |.|..||.||..:..      .:..||      :|.|:.|
  Fly    83 AQHLGENTVRTIAMDGTEGL-----VRGQKVLDTGYPIRI------PVGAET------LGRIINV 130

Mouse   113 IKKYGASFGEFIDK---LNEEKIAQLE----EVKQSSMKQ 145
            |       ||.||:   ::.:|.|.:.    |..|.|::|
  Fly   131 I-------GEPIDERGPIDTDKTAAIHAEAPEFVQMSVEQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp5pbNP_033855.2 Mt_ATP-synt_B 83..244 CDD:368426 16/70 (23%)
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 31/147 (21%)
ATP-synt_ab_N 46..112 CDD:280947 13/73 (18%)
F1-ATPase_beta 114..393 CDD:238553 16/69 (23%)
ATP-synt_ab_C 401..508 CDD:278722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3209
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.