DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp4b and CG33310

DIOPT Version :9

Sequence 1:NP_033854.1 Gene:Atp4b / 11945 MGIID:88114 Length:294 Species:Mus musculus
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:339 Identity:69/339 - (20%)
Similarity:120/339 - (35%) Gaps:115/339 - (33%)


- Green bases have known domain annotations that are detailed below.


Mouse     8 KSCSQRM---AEFRHYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLMQTIDPY 69
            |.|....   .|:|...:|...|:...|.|:.|:: :|.::..|::...:|::..:         
  Fly   572 KGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWF--------- 626

Mouse    70 TPDYQDQLKSPGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSINCTSE 134
                 |.:|                      .:.|....:......|:: :||...:     |:.
  Fly   627 -----DFIK----------------------DDASRKVPMIKMAQPFIS-FTPIGPR-----TNP 658

Mouse   135 KYFFQESFAAPNHTKFSCKFTADM--------------LQNCSGLADPSFGFEEGKPCFIIKMNR 185
            |   ..||...|.|:...|:...|              ...|:  |:..||:..|:||..:|:||
  Fly   659 K---AVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCT--ANEKFGYPSGEPCVFLKVNR 718

Mouse   186 IVKF--------------------------LPSNNTAP-----RVDCTFQDDPQKPRKDTEPLQV 219
            |:.|                          |..|.|..     |...|.:.|     ||...| :
  Fly   719 IIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSD-----KDKNVL-I 777

Mouse   220 EYYPPNGTFS--------LHYFPYYGKKA--QPHYSNPLVAAKLLNVPKNMQVSIVCKILADHVT 274
            |::|.....:        :.|....|||:  .|:..|.:||.|:.|:..|.:|.|.||:.|.:: 
  Fly   778 EFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI- 841

Mouse   275 FNNPHDPYEGKVEF 288
             ::..:.| |:|.|
  Fly   842 -HHRKEGY-GQVSF 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp4bNP_033854.1 Na_K_ATPase_bet 2..294 CDD:273446 69/339 (20%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 29/110 (26%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 37/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.