DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSTO2 and GstE7

DIOPT Version :10

Sequence 1:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:193 Identity:43/193 - (22%)
Similarity:81/193 - (41%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINLR---NKPEWYYTKHPFGHIPVLETSQCQLIYESV 87
            :|.:...|.....:|.|.|.::.:|.|.:|.|   |..|.:..|:|...:|.|| .....|::|.
  Fly     6 LYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLE-DDGHYIWDSH 69

Human    88 IACEYLDDAYPGR--KLFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGRECTNLKA--- 145
            ....||...| |:  .|:|.|..:||  .|::..|......:..:.....|..|::....|.   
  Fly    70 AIIAYLVS
KY-GKTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLFAGKQTMIPKERYD 133

Human   146 ALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMK 208
            |:.:.:..||:.|  ....:..|..:::.|:.:......|:|:..:|...: |.:..|...::
  Fly   134 AIIEVYDFLEKFL--AGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKY-PRIAAWFKRLQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GSTO2NP_899062.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 7..94 CDD:469754 19/70 (27%)
GST_C_Omega 108..230 CDD:198293 18/106 (17%)
GstE7NP_611329.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 18/106 (17%)

Return to query results.
Submit another query.