DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp1b1 and GABA-B-R1

DIOPT Version :9

Sequence 1:NP_033851.1 Gene:Atp1b1 / 11931 MGIID:88108 Length:304 Species:Mus musculus
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster


Alignment Length:294 Identity:51/294 - (17%)
Similarity:90/294 - (30%) Gaps:110/294 - (37%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDR--VAPPGLT 78
            |||..:: .:..:......|:||.||.  ||..:.:..|....::..|.....|.|  :...|.|
  Fly   487 IWNKHRR-VIQSSHPVCNTIMLFGVII--CLISVILLGIDGRFVSPEEYPKICQARAWLLSTGFT 548

Mouse    79 --------QIPQIQKTEISFRPNDPKSYEAYVL------------------NIIRFLEKYKDSAQ 117
                    ::.::.:.....:.:..|..|.:.|                  .|...|::|.::..
  Fly   549 LAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFP 613

Mouse   118 KDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSG--------------------- 161
            .:|.:     :...:.|.|.::.|...:|...     |||...|                     
  Fly   614 LEDPV-----STTDDIKIRPELEHCESQRNSM-----WLGLVYGFKGLILVFGLFLAYETRSIKV 668

Mouse   162 --LNDDSYG----YREGKPCIIIK--------------------------LNRVLGFKPK----- 189
              :||..|.    |.....|:|..                          |:.:|.|.||     
  Fly   669 KQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVI 733

Mouse   190 -PPKNESLETYPLMMKYNPNVLPVQCTGKRDEDK 222
             .||:::      ..||||:    ....|.||::
  Fly   734 RHPKDKA------ESKYNPD----SAISKEDEER 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp1b1NP_033851.1 Na_K_ATPase_bet 1..304 CDD:273446 51/294 (17%)
immunoglobulin-like. /evidence=ECO:0000250 191..304 9/32 (28%)
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 42/255 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.