DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog2 and dimm

DIOPT Version :9

Sequence 1:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:115/284 - (40%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 GSASP---ASATLTPMSSS--------ADEEEDEELRRPGSARG-----QRGAEAGQGVQGSPAS 69
            ||:.|   |:...:.:|::        :..:.|:.....||:.|     ..|..:|..:.|...|
  Fly    44 GSSRPVRRATRRTSQLSNNTYDLEMTDSSSQSDDTSGGGGSSNGGGSTTNTGHPSGCSLGGQGPS 108

Mouse    70 G--------AGGC----RPGRLLGLMHECKRRPSRSRAVSRGAKTAETVQRIKKTRRLKANNRER 122
            |        :|.|    .|..............||.|   :||..|:.    :..|||::|.|||
  Fly   109 GRGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRR---KGALNAKE----RNMRRLESNERER 166

Mouse   123 NRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALT---------ETLRLADHCAGAG 178
            .|||:||.|..:||||:|....:.:|:|||||..|.|||..||         |...|..:....|
  Fly   167 MRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHIILSKRNEEAAALELNSGAVG 231

Mouse   179 GL--------QGALFTEAVLLSPGAALGASGDSPSPPSSWSCTNSPASSSNSTSPYSCTLSPA-- 233
            |:        .|......:..:..||.....|:.:...::.|....|:..:..:..:.|.|||  
  Fly   232 GVLLSNLSSESGGPVASGIPANSNAATICFEDTLASGGAFDCAILAATDGSLLNAATVTTSPAMQ 296

Mouse   234 SPGSDVDYWQPPPPEKHRYAPHLP 257
            |..|...:.|.|..::.:.|.|||
  Fly   297 SIQSQAIHLQTPMEQQQQQASHLP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76 16/82 (20%)
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 32/76 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253 11/57 (19%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.