DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog2 and amos

DIOPT Version :10

Sequence 1:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:78 Identity:35/78 - (44%)
Similarity:46/78 - (58%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    91 SRSRAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLR 155
            |.|.|.|..:.:|.....:.|.|||.||.|||.||::||.|.|.||:|:|:...|.:|:|.|||:
  Fly   117 STSSASSSSSSSAGFGGEVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQ 181

Mouse   156 FAHNYIWALTETL 168
            .|..||..|...|
  Fly   182 MAQAYIGDLVTLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 30/65 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253
amosNP_477446.1 bHLH_TS_amos_like 132..195 CDD:381558 30/63 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.