DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurog2 and Hand

DIOPT Version :10

Sequence 1:NP_033848.1 Gene:Neurog2 / 11924 MGIID:109619 Length:263 Species:Mus musculus
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:67 Identity:30/67 - (44%)
Similarity:39/67 - (58%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse   102 TAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTE 166
            |:.|  ||.| :|..||.:||.|..::|.|...|||.:|..|.|.||:||:||:.|..||..|..
  Fly    51 TSNT--RIVK-KRNTANKKERRRTQSINNAFSYLREKIPNVPTDTKLSKIKTLKLAILYINYLVN 112

Mouse   167 TL 168
            .|
  Fly   113 VL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurog2NP_033848.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..76
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 29/65 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..253
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.