DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neurod4 and net

DIOPT Version :9

Sequence 1:NP_001316418.1 Gene:Neurod4 / 11923 MGIID:108055 Length:330 Species:Mus musculus
Sequence 2:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster


Alignment Length:148 Identity:46/148 - (31%)
Similarity:75/148 - (50%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 SSQNEMKEQERRPGSYGMLGTLTEEHDSIEEDEEEEEDG----DKPKRRGPKKKKMTKARLERFR 86
            |::..:||:.::.      .|.:...::...||:..:.|    .:|.:.....|.||       |
  Fly   216 SAKKTLKERTQKE------STSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMT-------R 267

Mouse    87 ARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQTLEG 151
            .||::||||||||:|.::.|.:.||:.:|.|:.||||||:..||:|.:||..||.:  .|:....
  Fly   268 ERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM--AGEDYSA 330

Mouse   152 KGFVEMLCKGLSQPTSNL 169
            ...|..:...|...||.:
  Fly   331 DQSVPSIATCLEAVTSTI 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Neurod4NP_001316418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..80 11/57 (19%)
HLH 88..144 CDD:238036 29/55 (53%)
Neuro_bHLH 146..263 CDD:289310 5/24 (21%)
netNP_001259789.1 HLH 269..320 CDD:278439 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.